| PDBID: | 8u2k | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL1 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human GABARAPL2 soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinolato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2i | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL2 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinlinato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2f | | Status: | HPUB -- hold until publication | | Title: | Vibrio parahaemolyticus ToxS periplasmic domain | | Authors: | Kim, M., Kull, F.J., Midgett, C.R. | | Deposition date: | 2023-09-06 | | Sequence: | >Entity 1
MSDLKVEQVLTSNEWQSTMVTVITDNLPDDTVGPLRRVNVESNVKYLPNGDYIRVSNIKLFAQGSTAESTINISEKGRWEVSDNYLLVSPSEFKDISSSQSKDFSEAQLRLITQIFKLDAEQSRRIDVVNEKTLLLTSLNHGSTVLFRN
|
|
| PDBID: | 8u2a | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-05 | | Release date: | 2024-09-05 |
|
| PDBID: | 8u25 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F/E166A/L167F Triple Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8u1z | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8u1y | | Status: | HPUB -- hold until publication | | Title: | E.coli DsbA in complex with N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-04 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8u1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8u1h | | Status: | HPUB -- hold until publication | | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8u1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8u1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8u0y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8u0r | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of protein A21, a component of the conserved poxvirus entry-fusion complex | | Authors: | Diesterbeck, U., Gittis, A.G., Garboczi, D.N., Moss, B. | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8u0i | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-29 | | Release date: | 2024-08-29 |
|
| PDBID: | 8u0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8u0f | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8u0e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-29 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-29 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-29 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u0b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-28 |
|
| PDBID: | 8u0a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-28 |
|
| PDBID: | 8u07 | | Status: | HPUB -- hold until publication | | Title: | Imine reductase RedE bound with NADP+ and arcyriaflavin A (secondary site) | | Authors: | Daniel-Ivad, P., Ryan, K.S. | | Deposition date: | 2023-08-28 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMGAKVTVLGLGPMGAALAGAFLAAGHRTTVWNRTPGKGGSLAGEGATEVASAAEAVAASPLVVVCLATYEAVHEVLDPLADELAGRTVVNLTSGSPVHARETANWAQQHGAEYLDGVIMTTPSGIGKPDYLLLYSGSQAAFDGSRGTLCALGEPMNLGTDAAMASVYDTALLGLMWGTLTGWLHGVALMGADGPGGNVTATAFTEVANRWMKTVGVFMNTYAPHVDAGHYPGDEFTLHLHHRTMNILAHASELRGVVSGLPELLTELTGRAITAGHGNDSYARLVEFIRKDGSPI
|
|
