PDBID: | 8s4m | Status: | HPUB -- hold until publication | Title: | Crystal structure of Mycobacterium tuberculosis cytochrome P450 CYP125 in complex with an inhibitor | Authors: | Snee, M., Kavanagh, M., Levy, C. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4k | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4j | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4i | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4h | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 | Sequence: | >Entity 1 MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8s4e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8s44 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s43 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8s42 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s41 | Status: | HPUB -- hold until publication | Title: | The structure of the copia retrotransposon icosahedral capsid (T=9) | Authors: | Klumpe, S., Beck, F., Briggs, J.A.G., Beck, M., Plitzko, J.M. | Deposition date: | 2024-02-20 |
|
PDBID: | 8s40 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3z | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3y | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3w | Status: | HPUB -- hold until publication | Title: | LysTt72, a lytic endopeptidase from Thermus thermophilus MAT72 phage vB_Tt72 | Authors: | Rypniewski, W., Biniek-Antosiak, K., Bejger, M. | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3v | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3u | Status: | HPUB -- hold until publication | Title: | LysTt72, a lytic endopeptidase from Thermus thermophilus MAT72 phage vB_Tt72 | Authors: | Rypniewski, W., Biniek-Antosiak, K., Bejger, M. | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3t | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3s | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3q | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3p | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-20 |
|
PDBID: | 8s3o | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2024-02-20 | Release date: | 2025-02-20 |
|
PDBID: | 8s3n | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-20 |
|