| PDBID: | 8v69 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v68 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v66 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v65 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v64 | | Status: | HOLD -- hold until a certain date | | Title: | RCK1-RCK2 double mutant of human Slo1 in presence of EDTA - resting VSD | | Authors: | Pal, K., Kallure, G.S., Chowdhury, S. | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v63 | | Status: | HOLD -- hold until a certain date | | Title: | R207A mutant of human Slo1 in presence of EDTA - activated VSD | | Authors: | Pal, K., Kallure, G.S., Chowdhury, S. | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v60 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v5v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v5u | | Status: | HPUB -- hold until publication | | Title: | Human SIRT3 bound to p53-AMC peptide and Honokiol | | Authors: | Chakrabarti, R., Ghosh, A., Guan, X., Upadhyay, A., Dumpati, R.K., Munshi, S., Roy, S., Chall, S., Rahnamoun, A., Reverdy, C., Errasti, G., Delacroix, T. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
>Entity 2
QPK(FDL)
|
|
| PDBID: | 8v5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v5s | | Status: | HPUB -- hold until publication | | Title: | VZV glycoprotein E C-terminal domain (cleaved) in complex with human Fab 5A2 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5p | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the C-terminal domain of the VZV gE ectodomain in complex with the Fab of human antibody 5A2 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5l | | Status: | HPUB -- hold until publication | | Title: | Structure of the Varicella Zoster Virus (VZV) gI binding domain of glycoprotein E (gE) in complex with human Fab 1A2 and 1E12 | | Authors: | Seraj, N., Holzapfel, G., Harshbarger, W. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MAP4K4 in complex with an inhibitor | | Authors: | Greasley, S.E., Diehl, W. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of MASTL Kinase domain in complex with an inhibitor | | Authors: | Greasley, S.E., Diehl, W. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5b | | Status: | HPUB -- hold until publication | | Title: | Structure of the oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB_Ec F70A/F108Y in complex with FMN | | Authors: | Sharrock, A.V., Ackerley, D.F., Arcus, V. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v58 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound heparan sulfate 12mer | | Authors: | Pedersen, L.C., Xu, D., Krahn, J.M. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v57 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound cystatin C inhibitor | | Authors: | Pedersen, L.C., Xu, D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
