PDBID: | 8tk2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-25 |
|
PDBID: | 8tjs | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-24 |
|
PDBID: | 8tjr | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-24 |
|
PDBID: | 8tjp | Status: | HPUB -- hold until publication | Title: | KS-AT core of 6-deoxyerythronolide B synthase (DEBS) Module 3 crosslinked with its elongation ACP partner | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | Deposition date: | 2023-07-23 |
|
PDBID: | 8tjo | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 1 in complex with antibody fragment 1B2: Crosslinked Intra-State 1 | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | Deposition date: | 2023-07-23 |
|
PDBID: | 8tjn | Status: | HPUB -- hold until publication | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 1 in complex with antibody fragment 1B2: Crosslinked State 1 | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | Deposition date: | 2023-07-23 |
|
PDBID: | 8tjh | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-21 |
|
PDBID: | 8tio | Status: | HPUB -- hold until publication | Title: | Human ACKR3 with C tail extended by 12 glycines phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2023-07-19 | Release date: | 2025-01-22 |
|
PDBID: | 8tin | Status: | HPUB -- hold until publication | Title: | Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without receptor/micelle | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2023-07-19 | Release date: | 2025-01-22 |
|
PDBID: | 8til | Status: | HPUB -- hold until publication | Title: | Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without receptor/micelle | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2023-07-19 | Release date: | 2025-01-22 |
|
PDBID: | 8tik | Status: | HPUB -- hold until publication | Title: | Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 reconstructed without receptor/micelle | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2023-07-19 | Release date: | 2025-01-22 |
|
PDBID: | 8tij | Status: | HPUB -- hold until publication | Title: | Human ACKR3 phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2023-07-19 | Release date: | 2025-01-22 |
|
PDBID: | 8tii | Status: | HPUB -- hold until publication | Title: | Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 in nanodisc | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2023-07-19 | Release date: | 2025-01-22 |
|
PDBID: | 8tih | Status: | HPUB -- hold until publication | Title: | Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2023-07-19 | Release date: | 2025-01-22 |
|
PDBID: | 8tig | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human ACKR3 phosphorylated by GRK5 in complex with Arrestin2 | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2023-07-19 | Release date: | 2025-01-22 |
|
PDBID: | 8tia | Status: | HPUB -- hold until publication | Title: | CryoEM structure of locally-refined tetramer of Shedu nuclease domain from Bacillus cereus | Authors: | Gu, Y., Corbett, K. | Deposition date: | 2023-07-19 |
|
PDBID: | 8ti9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CryoEM structure of octamer assembly of Shedu nuclease domain from Bacillus cereus | Authors: | Gu, Y., Corbett, K. | Deposition date: | 2023-07-19 |
|
PDBID: | 8ti8 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of Shedu from Bacillus cereus | Authors: | Gu, Y., Corbett, K. | Deposition date: | 2023-07-19 |
|
PDBID: | 8ti3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-19 |
|
PDBID: | 8thz | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-18 |
|
PDBID: | 8thy | Status: | HPUB -- hold until publication | Title: | yeast actin A167E mutant rabbit-like | Authors: | Volkmann, N., Hanein, D. | Deposition date: | 2023-07-18 |
|
PDBID: | 8thx | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-18 |
|
PDBID: | 8thw | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-18 | Release date: | 2024-11-17 |
|
PDBID: | 8thq | Status: | HPUB -- hold until publication | Title: | Nonamer RNA bound to hAgo2-PAZ | Authors: | Pallan, P.S., Harp, J.M., Egli, M. | Deposition date: | 2023-07-17 |
|
PDBID: | 8tho | Status: | HPUB -- hold until publication | Title: | Solution structure of the zinc finger repeat domain of BCL11A (ZnF456) | Authors: | Viennet, T., Yin, M., Orkin, S.H., Arthanari, H. | Deposition date: | 2023-07-17 | Sequence: | >Entity 1 SEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
|
|