PDBID: | 8wk0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjz | Status: | HPUB -- hold until publication | Title: | Crystal structure of AtHPPD-F419Y+Y13161 complex | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjx | Status: | HPUB -- hold until publication | Title: | ADP-bound purinergic receptor 1 in complex with miniGs/q | Authors: | Gu, Q.C., Tang, W.Q. | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjw | Status: | HPUB -- hold until publication | Title: | Aldo-keto reductase KmAKR-W297H/Y296W | Authors: | Xu, S.Y., Zhou, L., Xu, Y., Wang, Y.J., Zheng, Y.G. | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjv | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of T2R-TTL-IKP104-Colchicine | Authors: | Yang, J.H., Yang, J.H. | Deposition date: | 2023-09-26 | Release date: | 2024-09-26 |
|
PDBID: | 8wju | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with DmBrPhe and an ATP analogue | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjt | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with CbzK and an ATP analogue | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjs | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with AllocK and an ATP analogue | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjr | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjq | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjp | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjm | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 | Sequence: | >Entity 1 ESPSGYIKKVILRNFMCHEHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSLKDLIREGCYSAKIILHLDNSKYGAYQQGIFGNEIIVERIIKRDGPASFSLRSENGKEISNKKKDIQTVVDYFSVPVSNPMCFLSQDAARSFLTASTSQDKYSHFMKGTLLQEITENLLYASAIHDSAQENMALHLENLKSLKAEYEDAKLNQTSDLNERKMLLQAKSLWIDVAHNTDAAALKEGIQRQIQNACAFCSKERIENVDLPDTQEEIKRELDKVSRMIQKAEKSLGLSQEEVIALFEKCRNKYKEGQKKYMEIDEALNRLHNSLKARDQNYKNAEKGTCFDADMDFRASLKVRKFSGNLSFIKDTKSLEIYILTTNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIARTQTIIITPQDIGKIADIDSSGVSIHRMRDP
>Entity 2 PDLSSFQPGSIIKIRLQDFVTYTLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDFIKNGQDVSKIEITLKNSPNVTDIEYIDARDETIKITRIITRSKRRSDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDASLLDVLDELRELQGNEQSLQKDLDFKKAKIVHLRQESDKLRKSVESLRDFQNKKGQLLPYVKVKDHKEKLNVKEMRDTPEFQSWMREIRSYDQDTKEKLNKVAEKYEEEGNFNLSFVQDVLDKLESEIAMVNHDESAVTILDQVTAELRELEHTVPQQSKDLETIKAKLKEDHAVLEPKLDDIVSKISARFARLFNNVGSAGAVRLEKPKDYAEWKIEIMVKFRDNAPLKKLDSHTQSGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFLITPKLLTGLHYHEKMRIHC
>Entity 3 PVTGDATAKYLLQYILSARGICHENALILALMRLETDASTLNTEWSIQQWVDKLNDYINAINVKLNLLGYKIIRINHGIGRNAVTLKAKQNFEDYAVLQSIVLPESNRFFVYVNLASAEETKLATRFNQNEIEFMKWAIEQFMISGETIVEGPALETSIIVKEVNRILVAATGDSNLAKWRKFSTFTVGSTNLFQFQELTATDIEDLLLRLCELKWFYRTQEGKFGIDLRCIAELEEYLTSMYNLNTCQNCHKLAIQGVRCGNESCREENEETGENSLSQIWHVDCFKHYITHVSKNCDRCGSSLITEGVYVI
>Entity 4 DLTEDLAVAKIVKENPVARKMVRYILSRGESQNSIITRNKLQSVIHEAAREENIAKPSFSKMFMDINAILYNVYGFELQGLPSKNNMEPLGHRAQKFILLNNVPHSKNFDDFKILQSAHTYEELIVTGEYIGDDIASGTSNTLESKLSTDRDLVYKGVLSVILCIVFFSKNNILHQELIKFLETFGIPSDGSKIAILNITIEDLIKSLEKREYIVRLEEKSDTDGEVISYRIGRRTQAELGLESLEKLVQEIMGLEKEQTKSLHDDIIKSIGDSYSI
>Entity 5 SKDGDPQLEFKVLQGYRDLESEMHKGRAQVTRTGDIGVAMDNLNAVDSLFNKVIGIKNNGLFAHDARAMVSISELAQISVRNLKFDDSRSMVNLENIVNSLKRYMLKEHFKLNNIAENRNDTSMRHSYLQQFSHYNEFSQFNWFRIGALYNTISKNAPITDHLMGPLAICFKKLSKKLGPEGSINLFKFIIDPNSFSRSIENLFYTSFLIKEGKLLMEHDEEGLPTIKIKQSISHTDSRSKEIERQRRRAAHQNHIIFQMDMPTWRKLIKKYNITSPFLD
|
|
PDBID: | 8wjk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-26 |
|
PDBID: | 8wji | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjh | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8wjg | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wjf | Status: | HPUB -- hold until publication | Title: | Unlocking Immunogenic Potential: Innovating a Peptide/Ferritin Fusion Tag Nano-Delivery Platform from de novo design to Significantly Enhance Antigenicity of the Rabies Virus Glycoprotein Domain III | Authors: | Fu, D., Wang, M., Guo, Y. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wje | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-25 | Release date: | 2024-09-25 |
|
PDBID: | 8wjd | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-25 | Release date: | 2024-09-25 |
|
PDBID: | 8wjc | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-25 | Release date: | 2024-09-25 |
|
PDBID: | 8wjb | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wja | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with LmBrPhe and an ATP analogue | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with MeHis and an ATP analogue | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with BocK and an ATP analogue | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with pyrrolysine and an ATP analogue | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-25 |
|