| PDBID: | 9beb | | Status: | HPUB -- hold until publication | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight Tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bea | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9be9 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 Env 16055 dGly4 NFL | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9be8 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be7 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9be5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9be4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-13 |
|
| PDBID: | 9be3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 9bdt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bds | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-12 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9bdr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTRV122delta, double filament morphology 1 | | Authors: | Nguyen, B.A., Ahmed, Y., Saelices, L. | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 9bdq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anti-abTCR NANOBODY VHH | | Authors: | Qiu, Y. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 9bdk | | Status: | HPUB -- hold until publication | | Title: | CP20.2 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdg | | Status: | HPUB -- hold until publication | | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85647 | | Authors: | Ferreira Ramos, A.S., Bajic, G. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdf | | Status: | HPUB -- hold until publication | | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85666 | | Authors: | Ferreira Ramos, A.S., Bajic, G. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bde | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of Non-Cognate Substrate Bound in the Entry Site (ES) of Human Mitochondrial Transcription Elongation Complex | | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of the TEFM bound Human Mitochondrial Transcription Elongation Complex in a Closed Fingers Domain Conformation | | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdb | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
