PDBID: | 9beb | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bea | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-15 |
|
PDBID: | 9be9 | Status: | HPUB -- hold until publication | Title: | HIV-1 Env 16055 dGly4 NFL | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9be8 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9be7 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9be6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 |
|
PDBID: | 9be5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 |
|
PDBID: | 9be4 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-13 |
|
PDBID: | 9be3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-13 |
|
PDBID: | 9bdt | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|
PDBID: | 9bds | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-12 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9bdr | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTRV122delta, double filament morphology 1 | Authors: | Nguyen, B.A., Ahmed, Y., Saelices, L. | Deposition date: | 2024-04-12 | Release date: | 2025-04-12 |
|
PDBID: | 9bdq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdo | Status: | HPUB -- hold until publication | Title: | Crystal structure of anti-abTCR NANOBODY VHH | Authors: | Qiu, Y. | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdm | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-12 | Release date: | 2025-04-12 |
|
PDBID: | 9bdk | Status: | HPUB -- hold until publication | Title: | CP20.2 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdj | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdi | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdh | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdg | Status: | HPUB -- hold until publication | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85647 | Authors: | Ferreira Ramos, A.S., Bajic, G. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdf | Status: | HPUB -- hold until publication | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85666 | Authors: | Ferreira Ramos, A.S., Bajic, G. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bde | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdd | Status: | HPUB -- hold until publication | Title: | Cryo-EM Structure of Non-Cognate Substrate Bound in the Entry Site (ES) of Human Mitochondrial Transcription Elongation Complex | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdc | Status: | HPUB -- hold until publication | Title: | Cryo-EM Structure of the TEFM bound Human Mitochondrial Transcription Elongation Complex in a Closed Fingers Domain Conformation | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdb | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|