| PDBID: | 9d80 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-18 | | Release date: | 2025-08-18 |
|
| PDBID: | 9d7z | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-18 | | Release date: | 2025-08-18 |
|
| PDBID: | 9d7y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of scFv corresponding to human autoantibody b96.11 | | Authors: | Buckle, A.M., McGowan, S. | | Deposition date: | 2024-08-18 | | Release date: | 2025-08-18 |
|
| PDBID: | 9d7x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7u | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api137 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.85A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Fva1 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Water and chloride as allosteric inhibitors in WNK kinase osmosensing | | Authors: | Akella, R., Goldsmith, E.J. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BG505 HIV-1 Env with 2 CH103 WT Fabs bound | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BG505 HIV-1 Env with 1 CH103 WT Fab bound | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Mycobacterium tuberculosis 7,8-diaminopelargonic acid synthase (BioA) in complex with inhibitor C111 | | Authors: | Jayasinghe, Y.P., Ronning, D.R. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7l | | Status: | PROC -- to be processed | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Infectious B19V capsid | | Authors: | Lee, H., Hafenstein, S. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7j | | Status: | HPUB -- hold until publication | | Title: | Clostridium acetobutylicum alcohol dehydrogenase bound to NADP+ | | Authors: | Madzelan, P., Wilson, M.A. | | Deposition date: | 2024-08-16 | | Sequence: | >Entity 1
(MSE)GSSHHHHHHSSGLVPRGSH(MSE)KEYKYTVITGASSGIGYEAAKAFAKRGKNLIIIARRREKLEELKKEILHYNRSLKVIVKSIDLSITSNVYSLYDELKNYNIETLVNNAGFGDYSKVNNQNLEKVES(MSE)LSLNIEALVILSSLFVRDYEKIEGTQLINISSAGGYTIVPNAVIYCATKFFVSSFTEGLARELIEAKSNLKAKVLAPAATETEFGKVASDVKEYDYQEKFHKYHTSKQ(MSE)AEFLIKLYDNDYIVGKVDRNSFKFTLQNPIFDYA
|
|
| PDBID: | 9d7i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BG505 HIV-1 Env with one CH103 K75 N76 Fab bound | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BG505 HIV-1 Env with no CH103 K75 N76 Fab bound | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OXA-58-NA-1-157 20 min complex | | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OXA-58-NA-1-157 10 min complex | | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OXA-58-NA-1-157 7.5 min complex | | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OXA-58-NA-1-157 5 min complex | | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | | Deposition date: | 2024-08-16 |
|
