PDBID: | 9c6u | Status: | AUTH -- processed, waiting for author review and approval | Title: | [d2d3] Tensegrity triangle with deazapurine center and helical strands (strands 2+3) with P63 symmetry | Authors: | Vecchioni, S., Sha, R., Ohayon, Y., Galindo, M., Lopez-Chamorro, C., Jong, M., Woloszyn, K. | Deposition date: | 2024-06-09 |
|
PDBID: | 9c6t | Status: | HPUB -- hold until publication | Title: | Structure of the Human ISM1 TSR-AMOP domains | Authors: | Stayrook, S., Li, T., Klein, D.E. | Deposition date: | 2024-06-08 |
|
PDBID: | 9c6s | Status: | HPUB -- hold until publication | Title: | 18-mer Hematopoietic tubulin in complex with cryptophycin-52 | Authors: | Montecinos, F. | Deposition date: | 2024-06-08 |
|
PDBID: | 9c6r | Status: | HPUB -- hold until publication | Title: | Hematopoietic tubulin in complex with cryptophycin-52 | Authors: | Montecinos, F. | Deposition date: | 2024-06-08 |
|
PDBID: | 9c6q | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-08 |
|
PDBID: | 9c6o | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Multiple independent acquisitions of ACE2 usage in MERS-related coronaviruses | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Diseases, Veesler, D., Seattle Structural Genomics Center for Infectious Disease (SSGCID) | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6n | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6m | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6l | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6k | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6j | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6i | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6h | Status: | HPUB -- hold until publication | Title: | [d3] Tensegrity triangle with deazapurine center strand (strand 3) in R3 | Authors: | Vecchioni, S., Sha, R., Ohayon, Y., Galindo, M., Lopez-Chamorro, C., Jong, M. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6g | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Mcm double hexamer from human | Authors: | Liu, C., Xu, N., Lin, Q. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6f | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form with ATP (Asymmetric sites). | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6e | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6d | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of mutant NonPro1 Tautomerase Superfamily Member 8U6-S1P in complex with 3-bromopropiolate inhibitor | Authors: | Lancaster, E.B., Hardtke, H.A., Melkonian, T.R., Venkat Ramani, M.K., Johnson Jr., W.H., Baas, B.J., Zhang, Y.J., Whitman, C.P. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6c | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form with ATP (symmetric sites). | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6b | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6a | Status: | HPUB -- hold until publication | Title: | The CRISPR associated adenosine deaminase Cad1-CARF in the apo form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c69 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase, Cad1-CARF in the cA4 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c68 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase Cad1-CARF in the cA6 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c67 | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c66 | Status: | HPUB -- hold until publication | Title: | Structure of the Mena EVH1 domain bound to the polyproline segment of PTP1B | Authors: | LaComb, L., Fedorov, E., Bonanno, J.B., Almo, S.C., Ghosh, A. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c65 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 | Sequence: | >Entity 1 STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
|
|