PDBID: | 9gq9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 | Sequence: | >Entity 1 GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEIAHLLIKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
|
|
PDBID: | 9gq2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CSP1 H36A | Authors: | Basle, A., David, S., Dennison, C. | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpz | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpy | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpx | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpw | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpv | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpu | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpt | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gps | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpr | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpq | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpp | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpo | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpn | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpm | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gpl | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|