PDBID: | 9gah | Status: | HPUB -- hold until publication | Title: | Crystal structure of Complement Factor H central CCP domains 8-14 | Authors: | Monecke, T., Schmidt, C.Q., Niessing, D. | Deposition date: | 2024-07-29 |
|
PDBID: | 9gae | Status: | HOLD -- hold until a certain date | Title: | Respiratory supercomplex CI1-CIII2-CIV2 from alphaproteobacterium | Authors: | Yaikhomba, M., Hirst, J., Croll, T.I., Spikes, T.E. | Deposition date: | 2024-07-26 | Release date: | 2025-07-26 |
|
PDBID: | 9gad | Status: | HPUB -- hold until publication | Title: | Structure and catalytic mechanism of SAM-AMP lyase in Clostridium botulinum CorA-associated type III CRISPR system | Authors: | McMahon, S.A., Gloster, T.M., White, M.F., Graham, S., Chi, H. | Deposition date: | 2024-07-26 | Sequence: | >Entity 1 GANAMAHMGKTLRFEIVSGVNKGYFHTNSQSESLDLVGGIWQKIAKEEFEKSNIYVSAVIKPSKTVYNQEWGCPENGEETVVLTGVANEEFVDDIEKWKDTVIKLAKELKNQMKQSTLTCEFIETELHYFK
|
|
PDBID: | 9gab | Status: | HPUB -- hold until publication | Title: | Structure and catalytic mechanism of SAM-AMP lyase in Clostridium botulinum CorA-associated type III CRISPR system | Authors: | McMahon, S.A., Chi, H., Gloster, T.M., White, M.F., Graham, S. | Deposition date: | 2024-07-26 | Sequence: | >Entity 1 GANAMAHMGKTLRFEIVSGVNKGYFHTNSQSESLDLVGGIWQKIAKEEFEKSNIYVSAVIKPSKTVYNQEWGCPENGQETVVLTGVANEEFVDDIEKWKDTVIKLAKELKNQMKQSTLTCEFIETELHYFK
|
|
PDBID: | 9ga9 | Status: | HPUB -- hold until publication | Title: | Crystal structure hASF1A 156-cr7 | Authors: | Ochsenbein, F.O., Vitard, A.V. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga8 | Status: | HPUB -- hold until publication | Title: | The crystal structure of human Annexin A4 from crystals grown at 4 mM Calcium | Authors: | Ruggiero, A., Barra, G., Ghilardi, O., Scala, M.C., Sala, M., Di Micco, S., Bifulco, G., Campiglia, P., Vitagliano, L. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of human Annexin A4 derived from crystal grown at 4 mM CaCl2 and retro-soaking | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Scala, M.C., Sala, M., Campiglia, P., Bifulco, G., Ruggiero, A. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga6 | Status: | HPUB -- hold until publication | Title: | The crystal structure of human Annexin A4 derived from crystals grown in 40 mM of CaCl2 | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Bifulco, G., Campiglia, P., Sala, M., Scala, M.C., Ruggiero, A. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | MtUvrA2 bound to endogenous E. coli DNA | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga3 | Status: | HPUB -- hold until publication | Title: | MtUvrA2UvrB bound to damaged oligonucleotide | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | XPA crystal grown in HEK293 cell | Authors: | Melicher, F., Isabet, T., Chavas, L.M.G., Montaville, P. | Deposition date: | 2024-07-26 |
|
PDBID: | 9g9z | Status: | HOLD -- hold until a certain date | Title: | Respiratory supercomplex CI1-CIII2-CIV1 (respirasome) from alphaproteobacterium | Authors: | Yaikhomba, M., Hirst, J., Croll, T.I., Spikes, T.E. | Deposition date: | 2024-07-25 | Release date: | 2025-07-25 |
|
PDBID: | 9g9y | Status: | HPUB -- hold until publication | Title: | Respiratory supercomplex CI2-CIII2-CIV2 (megacomplex) from alphaproteobacterium | Authors: | Yaikhomba, M., Hirst, J., Croll, T.I., Spikes, T.E. | Deposition date: | 2024-07-25 |
|
PDBID: | 9g9x | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-25 |
|
PDBID: | 9g9w | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-25 |
|
PDBID: | 9g9v | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-25 |
|
PDBID: | 9g9u | Status: | HOLD -- hold until a certain date | Title: | The structure of XynX, a NIF3 family protein from Geobacillus proteiniphilus T-6 | Authors: | Hadad, N., Pomyalov, S., Lavid, N., Shoham, Y., Shoham, G. | Deposition date: | 2024-07-25 | Release date: | 2025-07-25 |
|
PDBID: | 9g9t | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-25 | Release date: | 2025-07-25 |
|
PDBID: | 9g9s | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-25 |
|
PDBID: | 9g9r | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-25 |
|
PDBID: | 9g9q | Status: | HPUB -- hold until publication | Title: | Crystal structure of PbdA bound to p-methoxybenzoate. | Authors: | Hinchen, D.J., Wolf, M.E., Eltis, L.D., McGeehan, J.E. | Deposition date: | 2024-07-25 |
|
PDBID: | 9g9p | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-25 |
|