| PDBID: | 9ge3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9ge2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9ge1 | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera with disulfide bond cyclization (Ex-4-Tc5bCC) at 321K | | Authors: | Horvath, D. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9ge0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdw | | Status: | HPUB -- hold until publication | | Title: | RNA binding domain of Turnip crinkle virus p38, p38R | | Authors: | Weininger, U., Golbik, R., Thondorf, I., Behrens, S.E. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdv | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdu | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera with disulfide bond cyclization (Ex-4-Tc5bCC) at 310K | | Authors: | Horvath, D. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdt | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera with disulfide bond cyclization (Ex-4-Tc5bCC) at 299K | | Authors: | Horvath, D. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gds | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdr | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdq | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdp | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdn | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera with disulfide bond cyclization (Ex-4-Tc5bCC) at 288K | | Authors: | Horvath, D. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdl | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera with disulfide bond cyclization (Ex-4-Tc5bCC) at 277K | | Authors: | Horvath, D. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C-Methyltransferase SgMT from Streptomyces griseoviridis | | Authors: | Weiergraeber, O.H., Haase, M., Pietruszka, J. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdi | | Status: | HPUB -- hold until publication | | Title: | HUMAN PI3KDELTA IN COMPLEX WITH ISOCUMARIN INHIBITOR 10 | | Authors: | Pala, D., Bruno, P., Capelli, A.M., Biagetti, M. | | Deposition date: | 2024-08-05 | | Sequence: | >Entity 1
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
>Entity 2
YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
|
|
| PDBID: | 9gdh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TRIM24 PHD-BRD in complex with N-(2-(2-(2-acetamidoethoxy)ethoxy)ethyl)-3-(N-(1,3-dimethyl-2-oxo-6-(3-propoxyphenoxy)-2,3-dihydro-1H-benzo[d]imidazol-5-yl)sulfamoyl)benzamide (PEG linker unresolved) | | Authors: | Platt, M.A., Kot, E., Conway, S.J., Koekemoer, L. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gde | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
