PDBID: | 8qh5 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of UVSSA(VHS)-CSA-DDB1-DDA1 | Authors: | Lee, S.-H., Sixma, T.K. | Deposition date: | 2023-09-06 |
|
PDBID: | 8qh2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-06 |
|
PDBID: | 8qgz | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-06 |
|
PDBID: | 8qgx | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-06 |
|
PDBID: | 8qgv | Status: | HPUB -- hold until publication | Title: | Human Carbonic Anhydrase I in complex with 4-(5-acetyl-6-methyl-2-oxo-1,2,3,4-tetrahydropyrimidin-4-yl)benzenesulfonamide | Authors: | Angeli, A., Ferraroni, M. | Deposition date: | 2023-09-05 | Sequence: | >Entity 1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8qgs | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgr | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgq | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-09 |
|
PDBID: | 8qgp | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-11 |
|
PDBID: | 8qgo | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgn | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgm | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgl | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgk | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgj | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgi | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgh | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgg | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgf | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF AS-ISOLATED M148L MUTANT OF THREE-DOMAIN HEME-CU NITRITE REDUCTASE FROM RALSTONIA PICKETTII | Authors: | Petchyam, N., Antonyuk, S., Hasnain, S.S. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qge | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgd | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-11 |
|
PDBID: | 8qgc | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgb | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qga | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qg9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|