| PDBID: | 8rfj | | Status: | HPUB -- hold until publication | | Title: | DNA bound type IV-A1 CRISPR effector complex with the DinG helicase from P. oleovorans | | Authors: | Miksys, A., Cepaite, R., Malinauskaite, L., Pausch, P. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rfi | | Status: | HPUB -- hold until publication | | Title: | Ternary complex of HER2/ErbB2 extracellular domain (ECD) in compact conformation with trastuzumab (TZB) antibody | | Authors: | Gragera, M., Buschiazzo, A., Vacca, S. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rfb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the R243C mutant of human Prolyl Endopeptidase-Like (PREPL) protein involved in Congenital myasthenic syndrome-22 (CMS22) | | Authors: | Theodoropoulou, A., Cavani, E., Antanasijevic, A., Marcaida, M.J., Dal Peraro, M. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rfa | | Status: | HPUB -- hold until publication | | Title: | Arginase 2 in complex with an inhibitor | | Authors: | Petersen, J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rf7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rf1 | | Status: | HPUB -- hold until publication | | Title: | BmrA E504-R6G | | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rez | | Status: | HPUB -- hold until publication | | Title: | BmrA E504-apo | | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rey | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rex | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rew | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8reu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8ret | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8res | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rer | | Status: | HPUB -- hold until publication | | Title: | Major groove intercalation with Polypyridyl Ruthenium complex | | Authors: | Abdullrahman, A., Cardin, C.J., Hall, J.P. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8req | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rep | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8reo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8ren | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rem | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rel | | Status: | HPUB -- hold until publication | | Title: | Fab of an anti-PvAMA1 monoclonal antibody | | Authors: | Bentley, G.A., Saul, F.A., Vulliez-LeNormand, B. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rek | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR gamma Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-11 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 8rei | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reg | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
