| PDBID: | 8x96 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 A-particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x95 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 mature virion in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x94 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x92 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x8z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x8y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 with GNS-2660 inhibitor | | Authors: | Park, T.H., Bong, S.M., Lee, S.J., Lee, B.I. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x8x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 with GNS-2591 inhibitor | | Authors: | Park, T.H., Bong, S.M., Lee, S.J., Lee, B.I. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x8u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of F.occidentalis GABARAP | | Authors: | Zhang, S.Q., Luo, X., Wu, Z.L., Zhao, K.H., Li, X.Y. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8x8r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8x8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8h | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-27 | | Release date: | 2024-11-27 |
|
| PDBID: | 8x8f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipoxygenase from Enhygromyxa salina | | Authors: | Kim, J.W., Seo, P.W., Kim, J.S. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with four GlnR and two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x89 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Streptococcus pneumoniae fabG | | Authors: | Xu, K.M. | | Deposition date: | 2023-11-27 | | Sequence: | >Entity 1
MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM
|
|
| PDBID: | 8x86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x85 | | Status: | HPUB -- hold until publication | | Title: | Leptin-LepR dimer | | Authors: | Xie, Y.F., Shang, G.J., Qi, J.X., Gao, F.G. | | Deposition date: | 2023-11-27 |
|
