| PDBID: | 8yqa | | Status: | HPUB -- hold until publication | | Title: | Galectin-10 L27A | | Authors: | Su, J.Y., Sun, Y.Q. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq9 | | Status: | HPUB -- hold until publication | | Title: | Quadruple mutant (N51I+C59R+S108N+I164L) Plasmodium falciparum dihydrofolate reductase-thymidylate synthase (PfDHFR-TS V1/S) complexed with FB6, NADPH and dUMP | | Authors: | Vanichtanankul, J., Vitsupakorn, D., Saeyang, T., Arwon, U., Hoarau, M., Decharuangsilp, S., Kamchonwongpaisan, S., Yuthavong, Y. | | Deposition date: | 2024-03-19 | | Sequence: | >Entity 1
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETVDNVNDMPNSKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNKMLNEQNCIKGEEKNNDMPLKNDDKDTCHMKKLTEFYKNVDKYKINYENDDDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
|
|
| PDBID: | 8yq8 | | Status: | HPUB -- hold until publication | | Title: | Quadruple mutant (N51I+C59R+S108N+I164L) Plasmodium falciparum dihydrofolate reductase-thymidylate synthase (PfDHFR-TS V1/S) complexed with FB8, NADPH and dUMP | | Authors: | Vanichtanankul, J., Vitsupakorn, D., Saeyang, T., Arwon, U., Hoarau, M., Decharuangsilp, S., Kamchonwongpaisan, S., Yuthavong, Y. | | Deposition date: | 2024-03-19 | | Sequence: | >Entity 1
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETVDNVNDMPNSKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNKMLNEQNCIKGEEKNNDMPLKNDDKDTCHMKKLTEFYKNVDKYKINYENDDDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
|
|
| PDBID: | 8yq7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq3 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ratTRPV1 bount with inhibitor AMG9810 | | Authors: | Gao, Y.H., Li, Z.X. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yq1 | | Status: | HPUB -- hold until publication | | Title: | Linear form of FGF10 from Homo sapiens | | Authors: | Park, H.J., Park, Y.S., Lee, C.E., Kang, L.W. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yq0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypq | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypp | | Status: | HPUB -- hold until publication | | Title: | Structure of the tetrameric trans-autophosphorylation complex of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypo | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypn | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypm | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in prime-activation conformation | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypl | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric phosphomimetic mutant of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-17 |
|
