| PDBID: | 8yvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2592-2710 bound to H5.2 nanobody | | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvf | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 | | Sequence: | >Entity 1
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2
MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3
RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
| PDBID: | 8yve | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 16) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell:icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 19) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8yva | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8yv9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8yv8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yv7 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Thialysine N-epsilon-acetyltransferase from Caenorhabditis elegans | | Authors: | Wang, N., Ma, X. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yv4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yv3 | | Status: | HPUB -- hold until publication | | Title: | The heterotrimer structure of peptides derived from human collagen type I | | Authors: | Zhu, Y., Yang, X., Sun, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yv2 | | Status: | HPUB -- hold until publication | | Title: | BceAB dimer with flipped UPP bound | | Authors: | He, Y.T., Li, J.W., Luo, M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yv1 | | Status: | HPUB -- hold until publication | | Title: | UPP-bound BceAB in the presence of ATP | | Authors: | He, Y.T., Li, J.W., Luo, M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yv0 | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae-BceAB-APO-Peptidisc Sample. | | Authors: | He, Y.T., Li, J.W., Luo, M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yuz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mus musculus IgM pentamer | | Authors: | Xin, X., Lin, Y., Li, J., Min, L. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yuy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mus musculus IgM Fab bound to SARS-CoV2-Spike | | Authors: | Xin, X., Lin, Y., Li, J., Min, L. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yux | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mus musculus IgM hexamer bound to SARS-Cov2-Spike | | Authors: | Xin, X., Li, J., Min, L. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yus | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
