| PDBID: | 9qkw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qku | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qks | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hTEAD4 YAP binding domain (hTEAD4-YBD) in complex with peptide 6 | | Authors: | Pozzi, C. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GSHMRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
>Entity 2
(ACE)P(6CW)RLRK(NLE)PDSF(ALN)KPP(NH2)
|
|
| PDBID: | 9qkp | | Status: | HPUB -- hold until publication | | Title: | Structure of the cyanobacteria specific PRK from Chroococcidiopsis (Hyella disjuncta) PCC 6712 (P41212 crystal form) | | Authors: | Tufail, F., Yang, L., Murray, J.W. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qko | | Status: | HPUB -- hold until publication | | Title: | Structure of the cyanobacteria specific PRK from Chroococcidiopsis (Hyella disjuncta) PCC 6712 (P1 crystal form) | | Authors: | Tufail, F., Yang, L., Murray, J.W. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkm | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 16 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkl | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 15 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkk | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 14 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkj | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 13 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qki | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 12 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkh | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 11 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkg | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 10 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkf | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 9 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qke | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 8 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkd | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 7 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkc | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 6 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkb | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 5 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qka | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 4 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk9 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 3 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk8 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 2 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk7 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 1 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
