| PDBID: | 9b2p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2n | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of the quorum quenching lactonase GcL D122N mutant - monometal center | | Authors: | Corbella, M., Bravo, J.A., Demkiv, A.O., Calixto, A.R., Sompiyachoke, K., Bergonzi, C., Kamerlin, S.C.L., Elias, M. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2m | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin H1 New Caledonia 1999 in complex with monoclonal antibody Fab 43_S0008 | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B., Ataca, S., Kanekiyo, M. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2k | | Status: | HPUB -- hold until publication | | Title: | SpCas9 with dual-guide RNA in open conformation | | Authors: | Korolev, S., Gagnon, K. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2j | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2i | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2h | | Status: | HPUB -- hold until publication | | Title: | HIV-1 wild type protease with GRL-072-17A, a substituted tetrahydrofuran derivative based on Darunavir as P2 group | | Authors: | Wang, Y.-F., Agniswamy, J., Ghosh, A.K., Weber, I.T. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
| PDBID: | 9b2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of short chain dehydrogenase reductase 9 (short chain dehydrogenase reductase 9C4) in complex with NADH | | Authors: | Pakhomova, S., Belyaeva, O.V., Boeglin, W.E., Kedishvili, N.Y., Brash, A.R., Newcomer, M.E., Popov, K.M. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MLFWLLALLFLCAFLWNYKGQLKIADIADKYVFITGCDTGFGNLAARTFDKKGFRVIAACLTESGSAALKAKTSERLHTVLLDVTDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTELADPIKTTEKKLAIWKHLSPDIKQQYGEGYIEKSLHRLKSNTSSVNLDLSLVVGCMDHALTSLFPKTRYIAGKDAKTFWIPLSHMPAVLQDFLLLKQKVELANPKAV
|
|
| PDBID: | 9b2f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of short chain dehydrogenase reductase 9 (short chain dehydrogenase reductase 9C4) in complex with NAD+ | | Authors: | Pakhomova, S., Belyaeva, O.V., Boeglin, W.E., Kedishvili, N.Y., Brash, A.R., Newcomer, M.E., Popov, K.M. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MLFWLLALLFLCAFLWNYKGQLKIADIADKYVFITGCDTGFGNLAARTFDKKGFRVIAACLTESGSAALKAKTSERLHTVLLDVTDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTELADPIKTTEKKLAIWKHLSPDIKQQYGEGYIEKSLHRLKSNTSSVNLDLSLVVGCMDHALTSLFPKTRYIAGKDAKTFWIPLSHMPAVLQDFLLLKQKVELANPKAV
|
|
| PDBID: | 9b2e | | Status: | HPUB -- hold until publication | | Title: | DHNA associated with an inhibitor | | Authors: | Czeczot, A.M., Silva, E.E.D., Timmers, L.F.S.M., Machado, P., Basso, L.A., Bizarro, C.V. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b2c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the Porcine deltacoronavirus (PDCoV) receptor-binding domain bound to the PD33 antibody Fab fragment and the Kappa light chain nanobody | | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Disease (SSGCID), Veesler, D. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b2b | | Status: | HPUB -- hold until publication | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with a Complete Estrogen Receptor Antagonists that Favors Tetramer Formation | | Authors: | Fink, E.C., Chawla, R., Wells, K.S., Barratt, S., Myles, D.C., Pena, G., Robello, B.W., Ng, R., Fanning, S.W. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b2a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b29 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b28 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b26 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cod allergen Gad m 1.0201 coordinating lanthanum | | Authors: | O''Malley, A., Chruszcz, M. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b25 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the ER-alpha Ligand-binding Domain (L372S, L536S) in complex with NA98 | | Authors: | Nwachukwu, J.C., Min, C.K., Papa, A., Rangarajan, E.S., Izard, T., Sharma, A., Nettles, K.W. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b24 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | WT strain gidB mutant mycobacterial ribosome | | Authors: | Young, I.D., Chen, Y., Javid, B., Fraser, J.S. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b23 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b1y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | WT strain WT mycobacterial ribosome | | Authors: | Chen, Y., Young, I.D., Fraser, J.S., Javid, B. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b1x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HWS19 strain gidB mutant mycobacterial ribosome | | Authors: | Chen, Y., Young, I.D., Fraser, J.S., Javid, B. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b1w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HWS19 strain WT mycobacterial ribosome | | Authors: | Young, I.D., Chen, Y., Javid, B., Fraser, J.S. | | Deposition date: | 2024-03-14 |
|
