| PDBID: | 9bdb | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bda | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bd9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS CoV-2 full-length spike protein, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd5 | | Status: | HPUB -- hold until publication | | Title: | Laccase from Bacillus licheniformis | | Authors: | Habib, M.H., Smith, T.J. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MKLEKFVDKLPIPKVLKPHSKSKEMTYYEVTMKEFQQQLHRDLPPTRLFGYNGVYPGPTFEVQKHEKVAVKWLNKLPDHHFLPVDHTIHDDGHHEHEVKTVVHLHGGRTPPDSDGYPEAWYTKDFQVKGPFFEREVYEYPNEQDATALWYHDHAMAITRLNVYAGLVGLYFIRDREERSLNLPKGEYEIPLLIQDKSFHEDGSLFYPRQPDNPSPDLPDPSIVPAFCGDTILVNGKVWPYDELEPRKYRFRILNASNTRIFELYFDHDITFHQIGTDGGLLQHPVKVNELVIAPAERCDIIVDFSRAEGKTVTLKNRIGCSGQDADPDTDANIMQFRISKPLKQKDTSSLPRILRKRPFYRRHKINTLRNLSLGASLDQYGRPVLLLNNTKWHEPVTETPALGSTEIWSIINAGRAIHPIHLHLVQFLILDHRPFDIERYQENGELVFTGPAAPPAQNEKGLKDTVKVPPGSVTRIIATFAPYSGRYVWHCHILEHEDYDMMRPLEVTDIRHQEFEAWARTKTHLRRGSE
|
|
| PDBID: | 9bd4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MAGE-A3 MHD crystal soaked with KL861 | | Authors: | Butrin, A., Crews, C. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 9bd1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-10 |
|
| PDBID: | 9bcy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Mayaro virus capsid C-terminal domain | | Authors: | Bezerra, E.H.S., Scorsato, V., Tonoli, C.C., Benedetti, C.E., Marques, R.E. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 9bcx | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the S. cerevisiae ORC-Cdc6-Mcm2-7-DNA complex with a fully closed Mcm2-Mcm5 DNA entry gate | | Authors: | Yuan, Z., Bai, L., Li, H., Speck, C. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 9bcw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | PawS-Derived Peptides with two disulfide bonds can adopt different structural folds | | Authors: | Hajiaghaalipour, F., Wong, W., Payne, C.D., Fisher, M.F., Clark, R.J., Mylne, J.S., Rosengren, K.J. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bcv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bcu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bct | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bcs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bcr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-09 | | Release date: | 2025-04-09 |
|
| PDBID: | 9bcq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bcp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bco | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bcn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bcm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bcl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bck | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
