| PDBID: | 9kdr | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of TrkA kinase in complex with RT1 | | Authors: | Zhang, Z.M., Wang, L. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thioredoxin gluthathione reductase from Schistosoma japonicum with the U597C mutation in complex with auranofin | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oxidized state of TRP14 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the reduced state of TRP14 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oxidized state of Trx1 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the reduced state of Trx1 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9ke3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9kea | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LnzB (Streptomyces spp. ) | | Authors: | Zhang, Z.M., Wang, L. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9kee | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 | | Sequence: | >Entity 1
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH
|
|
| PDBID: | 9ke7 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 23 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9keb | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 24 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9ked | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of spiny eel influenza-like virus HA | | Authors: | Sun, J.Q., Zhang, D. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kec | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 25 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9kds | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of human AURKA kinase domain in complex with RA1 | | Authors: | Zhang, Z.M., Wang, L. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9e7m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-03 |
|
| PDBID: | 9e7n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-03 |
|
| PDBID: | 9e7o | | Status: | HPUB -- hold until publication | | Title: | Pfs230 D13D14 in complex with nanobody W2810 | | Authors: | Dietrich, M.H., Tan, L.L., Tham, W.H. | | Deposition date: | 2024-11-03 |
|
| PDBID: | 9e7p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-03 |
|
| PDBID: | 9kd9 | | Status: | HPUB -- hold until publication | | Title: | The structure of RNA polymerase II elongation complex paused at N-5 state by actinomycin D. | | Authors: | Xu, J., Zhao, W., Zhu, L. | | Deposition date: | 2024-11-03 |
|
| PDBID: | 9kdn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-03 |
|
| PDBID: | 9kdo | | Status: | HPUB -- hold until publication | | Title: | The structure of 2 ACTD bound to RNA polymerase II elongation complex with 3 CTG repeats | | Authors: | Xu, J., Zhao, W., Zhu, L. | | Deposition date: | 2024-11-03 |
|
| PDBID: | 9kdq | | Status: | HPUB -- hold until publication | | Title: | The structure of 3 ACTD bound to RNA polymerase II elongation complex with 4 CTG repeats. | | Authors: | Xu, J., Zhao, W., Zhu, L. | | Deposition date: | 2024-11-03 |
|
| PDBID: | 9kdf | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of Calcineurin-fusion Human endothelin receptor type-B in complex with RES-701-3 | | Authors: | Shihoya, W., Akasaka, H., Nureki, O. | | Deposition date: | 2024-11-03 |
|
