| PDBID: | 9ibf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-12 | | Release date: | 2026-02-12 |
|
| PDBID: | 9iba | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibh | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Salmonella typhimurium polynucleotide phosphorylase in complex with recognition site of RNase E | | Authors: | Paris, G., Luisi, B.F. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibk | | Status: | HPUB -- hold until publication | | Title: | Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics | | Authors: | Pfuhl, M., Gage, M. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIDPFTIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEKGELRSGC
|
|
| PDBID: | 9ibn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the peptidyl-prolyl isomerase (PPIase) from E. faecium | | Authors: | Napolitano, V., Kramarska, E., Berisio, R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nau | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nav | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ternary complex of human phosphoribosylglycinamidine synthase with the intermediate (iminophosphate) and ADP bound at the synthase site. | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nak | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to tRNA | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nah | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nam | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the absence of ligand | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nap | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nan | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of human ROCK2 in complex with inhibitor | | Authors: | Depetris, R.S., Poyurovsky, M. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9naq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nas | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to disordered U1A stem loop | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nat | | Status: | HPUB -- hold until publication | | Title: | X-ray diffraction structure of papain co-crystallized with leupeptin | | Authors: | Vlahakis, N.W., Flowers, C.W., Rodriguez, J.A. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lv1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H1 Haemagglutinin HN/18 from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of mutant H1 Haemagglutinin HN/18-HA FPP from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of H1 Haemagglutinin HN/18-HA2-L113S from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-11 | | Release date: | 2026-02-11 |
|
| PDBID: | 9lv4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
