| PDBID: | 9lm3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lmb | | Status: | HPUB -- hold until publication | | Title: | crystal structure of the F46H/L49D myoglobin mutant | | Authors: | Lin, Y.W. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lm8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of wuRFP-Pfr21 | | Authors: | Guangming, D., Zehui, X., Longxing, C. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lm9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of wuRFP-Pfr16-v34 | | Authors: | Guangming, D., Zehui, X., Longxing, C. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lly | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of RSV pre-F (sc9-10 DS-Cav1, strain A2) in complex with Fabs 1A2 and 1B6 | | Authors: | Liu, L., Zheng, Q., Li, S. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lle | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lli | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lkz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lla | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ornithine decarboxylase H216F mutant without PLP | | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llv | | Status: | PROC -- to be processed | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lll | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llr | | Status: | HPUB -- hold until publication | | Title: | The designed collagen heterotrimer peptides with various stabilizing side chain pairs | | Authors: | Zhang, R.X., Xu, F., Fan, S.L. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll3 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Enterobacter cloaca transaldolase in complex with D-fructose-6-phosphate. | | Authors: | Kamitori, S. | | Deposition date: | 2025-01-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHSMELYLDTSDVAAVKKLARIFPLAGVTTNPSIVAAGKTPLDELLPALHDALGGKGRLFAQVMATTAEGMVEDARKLRAIINDLVVKVPVTVEGLAAIKMLKAEGIPTLGTAVYGAAQGMLSALAGAEYVAPYVNRVDAQGGDGIQTVIELQQLLTLHAPQSKVLAASFKTPRQALDCLLAGCESITLPLDVAQQFITSPAVDAAIVKFEQDWQGAFGRTSI
|
|
| PDBID: | 9llw | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-17 | | Release date: | 2026-01-17 |
|
