| PDBID: | 9igo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9igp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9igm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ig7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-19 | | Release date: | 2026-02-19 |
|
| PDBID: | 9nel | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne7 | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA with an in-situ-generated mismatch in the Pol-backtracking state | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne8 | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA with an in-situ-generated mismatch in the mismatch-locking state | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne9 | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA with a pre-existing mismatch in the blocked conformation I | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nea | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA with a pre-existing mismatch in the blocked conformation II | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nej | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ndz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9neb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne4 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the A-chain of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne5 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the B-chain of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nec | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | AcA-EI-shaker with free peptide conformation A | | Authors: | Tan, X., Swartz, K.J. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9lxf | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxe | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxd | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 | | Sequence: | >Entity 1
MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
| PDBID: | 9lxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9lxj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [3,14,12-2] Shifted tensegrity triangle with an (arm,center,arm) distribution of (3,14,12) base pairs and 2 nt sticky ends | | Authors: | Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-02-18 |
|
