| PDBID: | 9lhj | | Status: | HPUB -- hold until publication | | Title: | UBE2N/UBE2V2 complexed with a covalent inhibitor | | Authors: | Li, S., Wu, X., Zhou, L., Lu, X. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9lhl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9lhk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9lhm | | Status: | HPUB -- hold until publication | | Title: | hPAC structure in the presence of MbCD | | Authors: | Zhang, H., Chen, X. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9hz0 | | Status: | HPUB -- hold until publication | | Title: | Protein kinase MKK7 in complex with K221 targeting compound 1 | | Authors: | Wiese, J.N., Mueller, M.P., Rauh, D. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9hz1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AlfB | | Authors: | Marina, A., Gallego del Sol, F. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9mtx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9mtp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with mRNA, A-site Q230-N5-methylated Release Factor 1, and P-site fMEAAAKC-peptidyl-tRNAcys at 2.40A resolution | | Authors: | Aleksandrova, E.V., Syroegin, E.A., Basu, R.S., Vassilevski, A.A., Gagnon, M.G., Polikanov, Y.S. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9mtq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with mRNA, A-site GGD-mutant Release Factor 1, and P-site fMEAAAKC-peptidyl-tRNAcys at 2.55A resolution | | Authors: | Aleksandrova, E.V., Syroegin, E.A., Basu, R.S., Vassilevski, A.A., Gagnon, M.G., Polikanov, Y.S. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9mtr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with mRNA, A-site GGS-mutant Release Factor 1, and P-site fMEAAAKC-peptidyl-tRNAcys at 2.80A resolution | | Authors: | Aleksandrova, E.V., Syroegin, E.A., Basu, R.S., Vassilevski, A.A., Gagnon, M.G., Polikanov, Y.S. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9mts | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with mRNA, A-site Q230-unmodified Release Factor 1, and P-site fMEAAAKC-peptidyl-tRNAcys at 2.70A resolution | | Authors: | Aleksandrova, E.V., Syroegin, E.A., Basu, R.S., Vassilevski, A.A., Gagnon, M.G., Polikanov, Y.S. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9mtt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with mRNA, A-site Q230-N5-methylated Release Factor 1, and P-site deacylated-tRNAcys at 2.60A resolution | | Authors: | Aleksandrova, E.V., Syroegin, E.A., Basu, R.S., Vassilevski, A.A., Gagnon, M.G., Polikanov, Y.S. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9mtu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo-ADC-1 beta-lactamase | | Authors: | Smith, C.A., Stewart, N.K., Vakulenko, S.B. | | Deposition date: | 2025-01-12 | | Sequence: | >Entity 1
MRFKKISCLLLSPLFIFSTSIYAGNTPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVKTDQQVLTFFKDWKPKNSIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLGAPAYGVKSTLPDMLSFIHANLNPQKYPADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTNRFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAIKK
|
|
| PDBID: | 9mtv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an apo-ADC-1 triple mutant | | Authors: | Smith, C.A., Stewart, N.K., Vakulenko, S.B. | | Deposition date: | 2025-01-12 | | Sequence: | >Entity 1
MRFKKISCLLLSPLFIFSTSIYAGNTPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVKTDQQVLTFFKDWKPKNSIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLGAPAYGVKSTLPDMLSFIHANLNPQKYPADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIFMKPNKVTAISKEPSVKMYHKTGTTNRSGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAIKK
|
|
| PDBID: | 9mtw | | Status: | PROC -- to be processed | | Title: | Crystal structure of ADC-1-ertapenem complex | | Authors: | Smith, C.A., Stewart, N.K., Vakulenko, S.B. | | Deposition date: | 2025-01-12 |
|
| PDBID: | 9lh5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-11 |
|
| PDBID: | 9lh4 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the cyclophilin 37 from Arabidopsis thaliana | | Authors: | Dong, S., Qin, X. | | Deposition date: | 2025-01-11 | | Release date: | 2026-01-11 |
|
| PDBID: | 9lh2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-11 |
|
| PDBID: | 9lh6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-11 |
|
| PDBID: | 9lh8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-11 |
|
| PDBID: | 9lh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-11 |
|
| PDBID: | 9lha | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-11 |
|
| PDBID: | 9lh3 | | Status: | HOLD -- hold until a certain date | | Title: | Vibrio cholerae cytolysin cradle loop mutant-Y194A half barrel pre-pore model | | Authors: | Chattopadhyay, K., Dutta, S., Chatterjee, A., Naskar, P., Singh, M. | | Deposition date: | 2025-01-11 | | Release date: | 2026-01-11 |
|
| PDBID: | 9lh1 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structures of Keap1-CD2 complexes | | Authors: | Zhuang, C.L., Yu, R.Z. | | Deposition date: | 2025-01-11 | | Release date: | 2026-01-11 |
|
| PDBID: | 9lhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-11 |
|
