| PDBID: | 9bu5 | | Status: | HPUB -- hold until publication | | Title: | CC ProXp-ala apo solution structure | | Authors: | Duran, A.D., Foster, M.P. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of AAV2 Rep68 bound to integration site AAVS1: Insights into the mechanism of DNA melting. | | Authors: | Escalante, C.R. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GPPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
>Entity 2
(DG)(DT)(DT)(DG)(DG)(DG)(DG)(DC)(DT)(DC)(DG)(DG)(DC)(DG)(DC)(DT)(DC)(DG)(DC)(DT)(DC)
>Entity 3
(DG)(DA)(DG)(DC)(DG)(DA)(DG)(DC)(DG)(DC)(DC)(DG)(DA)(DG)(DC)(DC)(DC)(DC)(DA)(DA)(DC)
|
|
| PDBID: | 9bu4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 mutant, Y435W, in complex with an allosteric inhibitor | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu9 | | Status: | HPUB -- hold until publication | | Title: | Mixed-valent (2/3) dimanganese SfbO | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bua | | Status: | HPUB -- hold until publication | | Title: | SfbO reconstituted with Mn(II) anaerobically | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bub | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9buc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bue | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human calcitonin Receptor in complex with Gs and cagrilintide in the CT-like conformation (repeat) | | Authors: | Cao, J., Belousoff, M.J., Johnson, R.M., Sexton, P.M., Wootten, D.L. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bud | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcg | | Status: | HPUB -- hold until publication | | Title: | Medicago truncatula 5''-ProFAR isomerase (HISN3) D57N mutant in complex with PrFAR | | Authors: | Witek, W., Imiolczyk, B., Ruszkowski, M. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcf | | Status: | HPUB -- hold until publication | | Title: | Medicago truncatula 5''-ProFAR isomerase (HISN3) D57N mutant in complex with ProFAR | | Authors: | Witek, W., Imiolczyk, B., Ruszkowski, M. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc6 | | Status: | HPUB -- hold until publication | | Title: | HEN EGG-WHITE Lysozyme incubated at 87% relative humidity | | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc7 | | Status: | HPUB -- hold until publication | | Title: | HEN EGG-WHITE Lysozyme incubated at 99% relative humidity | | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc8 | | Status: | HPUB -- hold until publication | | Title: | HEN EGG-WHITE Lysozyme incubated at 60% relative humidity | | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fca | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
