| PDBID: | 9huw | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F232 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9hv1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of tri-specific FMDV mAb-17 Fab | | Authors: | Ren, J., Duyvesteyn, H.M.E., Stuart, D.I. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hum | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-12-23 | | Release date: | 2025-12-23 |
|
| PDBID: | 9huu | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F223 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9huv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F224 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9mnv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mutant variant of mAb CV3-25 Fab in complex with SARS-CoV-2 spike stem helix peptide | | Authors: | Chandravanshi, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mno | | Status: | HPUB -- hold until publication | | Title: | Structure of the TelA-associated type VII secretion system chaperone LcpA in complex with the chaperone binding site of TelA | | Authors: | Garrett, S.R., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-12-23 | | Release date: | 2025-12-23 |
|
| PDBID: | 9mnq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM10-30 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-73 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mns | | Status: | HPUB -- hold until publication | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnu | | Status: | HPUB -- hold until publication | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-48 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqq | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z1198147845 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqr | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z56946871 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqs | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z56912586 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqt | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z104503564 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqu | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z969591530 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqw | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z431953146 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqx | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z218760918 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqy | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z1117899682 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqz | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z62452555 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hr0 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z607808530 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hr1 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z57036327 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hr2 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z56946871 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
