| PDBID: | 9moc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-25 |
|
| PDBID: | 9mod | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-25 |
|
| PDBID: | 9mo6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-25 |
|
| PDBID: | 9mo5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-25 |
|
| PDBID: | 9mo8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-25 |
|
| PDBID: | 9mo9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-25 |
|
| PDBID: | 9l6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l69 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6h | | Status: | HPUB -- hold until publication | | Title: | complex structure of methyltransferases SMYD2 and inhibitor (14) | | Authors: | Sun, Y.L., Lu, J., Lu, W.C., Zhao, K.H., Liu, Y.H., Cao, L.H. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6g | | Status: | HPUB -- hold until publication | | Title: | Cocrystallization of the flavin-dependent monooxygenase DpasF with the substrate leads to its complex with the product | | Authors: | Zhao, X.Y., Zhang, L.P., Zhu, Y.G., Zhang, C.S. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l66 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l68 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human STING in complex with F8W | | Authors: | Feng, Z.W., Zeng, T., Chen, M.R., Xiao, Y.B., Xu, X.L. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l63 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l64 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l65 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6e | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRas G12D (GDP) in complex with compound 1 | | Authors: | Amano, Y., Tateishi, Y. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRas G12D (GDP) in complex with ASP3082 | | Authors: | Amano, Y., Tateishi, Y. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6j | | Status: | HPUB -- hold until publication | | Title: | Structural studies on the conformation changes induced by ligand binding in an Adenine phosphoribosyltransferase (FnAPRT) from Fusobacterium nucleatum | | Authors: | Kim, B., Hwang, J., Do, H., Lee, J.H. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6m | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound. | | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | | Deposition date: | 2024-12-24 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
|
|
| PDBID: | 9l6n | | Status: | HOLD -- hold until a certain date | | Title: | PEDV 3CLpro mutant (C144A) in complex with nsp5/6 peptite substrate | | Authors: | Zhang, Y., Zhang, D., Shi, Y.J., Peng, G.Q. | | Deposition date: | 2024-12-24 | | Release date: | 2025-12-24 |
|
