| PDBID: | 9jnq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9jnr | | Status: | HPUB -- hold until publication | | Title: | McyI-MCLR co-crystal | | Authors: | Wang, Q., Xue, C. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9jns | | Status: | HPUB -- hold until publication | | Title: | 50S precursor - Erm complex (C-1) | | Authors: | Sengupta, S., Mukherjee, R., Pilsl, M., Bagale, S., Adhikary, A.D., Borkar, A., Pradeepkumar, P.I., Engel, C., Chowdhury, A., Kaushal, P.S., Anand, R. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9jnp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-23 | | Release date: | 2025-09-23 |
|
| PDBID: | 9jnn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9gv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9dpm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9dpl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jmz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jmy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-22 | | Release date: | 2025-09-22 |
|
| PDBID: | 9jn3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AvpGT in complex with Ara-A | | Authors: | Li, J.H., Wang, Z.Q., Zhang, Z.Y., Chen, W.Q. | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn4 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-22 | | Release date: | 2025-09-22 |
|
| PDBID: | 9jn5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-22 | | Release date: | 2025-09-22 |
|
| PDBID: | 9jn6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-22 | | Release date: | 2025-09-22 |
|
| PDBID: | 9jn1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Multidrug resistance-associated protein 2 in complex with AMP-PNP in active state | | Authors: | Chen, D.D., Zhao, P. | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human ALK2 kinase domain with R206H mutation in complex with RK783 | | Authors: | Sakai, N., Mishima-Tsumagari, C., Shirouzu, M. | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9gv3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex between Nb474 mutant R53A,D125A and Trypanosoma congolense fructose-1,6-bisphosphate aldolase | | Authors: | McNae, I.W., Dornan, J., Walkinshaw, M.D. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9gv4 | | Status: | HPUB -- hold until publication | | Title: | TBA G-quadruplex binding nanobody (free form) | | Authors: | Pevec, M., Hadzi, S. | | Deposition date: | 2024-09-21 | | Sequence: | >Entity 1
QVQLQESGGGLVQAGGSLRLSCAASGSRFSSNTMTWYRQAPGKQREWVATMRSIGTTRYASSVEGRFTLSRDNAKNTVYLQMNSLKPEDTAVYYCNLRRGGGIYWGQGTQVTVSSHHHHHH
|
|
| PDBID: | 9dpe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9dpd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SerRS dimer in complex with one SIRT2 | | Authors: | Yang, J., Zhang, Q., Lander, G.C., Yang, X. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9dpg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of PmHMGR bound to mevalonate, CoA and NAD 2 minutes 20 seconds after reaction initiation at pH 9 | | Authors: | Purohit, V., Steussy, C.N., Schmidt, T., Stauffacher, C.V., Rushton, P. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9dpj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Solution Structure of G12C mutant GppNHp-bound T35S KRAS4b | | Authors: | Sharma, A.K. | | Deposition date: | 2024-09-21 |
|
