| PDBID: | 9mqr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-06 | | Release date: | 2026-01-06 |
|
| PDBID: | 9mr1 | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 S2 monomer in complex with R125-61 Fab | | Authors: | Park, S., Bangaru, B., Ward, A.B. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9mr3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-06 | | Release date: | 2026-01-06 |
|
| PDBID: | 9mr0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9mr2 | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 S2 monomer in complex with NICA01A-1401 Fab | | Authors: | Park, S., Bangaru, B., Ward, A.B. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9mqq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM Structure of the Ring-Activated Zinc-Finger RNase (RAZR) in Complex with Phage Protein Gp77 | | Authors: | Zhang, T., Laub, M., Ghanbarpour, A. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9mqx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Electron-bifurcating Tungstopyranopterin-containing aldehyde oxidoreductase with NADH | | Authors: | Feng, X., Li, H. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9mqv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human 1122A11 Fab in complex with influenza virus neuraminidase from A/Singapore/INFIMH-16-0019/2016 (H3N2) | | Authors: | Zhu, X., Wilson, I.A. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9mqw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of influenza virus N2 neuraminidase from A/Singapore/INFIMH-16-0019/2016 (H3N2) | | Authors: | Zhu, X., Wilson, I.A. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hwz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hx0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hwo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CK2 catalytic subunit Alpha''C336S in complex with F2X entry screen fragment C02 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hwp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CK2 catalytic subunit Alpha''C336S in complex with fragment C02 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hwr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hws | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hwt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hwv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hww | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hwx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hwq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hx1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab fragment of an antibody that recognises all conformations of alpha-1-antitrypsin | | Authors: | Wan, M.S.M., Lomas, D.A., Irving, J.A. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hx2 | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of PPAR gamma Ligand Binding Domain in complex with CZ58 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2025-01-06 | | Sequence: | >Entity 1
GSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL
|
|
| PDBID: | 9hx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hwy | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of SARS-CoV-2 spike protein at pH 7.4 (RBD Opened state) | | Authors: | Jana, S., Lorenz, U.J. | | Deposition date: | 2025-01-06 |
|
| PDBID: | 9hx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-06 |
|
