PDBID: | 9qw3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepIII-HepII-HepI ligand | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | Deposition date: | 2025-04-14 | Sequence: | >Entity 1 GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
PDBID: | 9qw7 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-14 |
|
PDBID: | 9qw2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepII-HepI-PhosI ligand | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | Deposition date: | 2025-04-14 | Sequence: | >Entity 1 GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
PDBID: | 9qw4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic PhosII-HepII-HepI ligand | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | Deposition date: | 2025-04-14 | Sequence: | >Entity 1 GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
PDBID: | 9qwl | Status: | AUTH -- processed, waiting for author review and approval | Title: | Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343 | Authors: | Sauer, U.H., Cisneros, D.A. | Deposition date: | 2025-04-14 |
|
PDBID: | 9qwj | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2025-04-14 |
|
PDBID: | 9qwk | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2025-04-14 |
|
PDBID: | 9qw8 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-14 |
|
PDBID: | 9qw5 | Status: | HPUB -- hold until publication | Title: | Urate Oxidase from Aspergillus Flavus with its Inhibitor 9-Methyl Uric Acid by continuous serial electron diffraction (SerialED) | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | Deposition date: | 2025-04-14 |
|
PDBID: | 9qw6 | Status: | HPUB -- hold until publication | Title: | Urate Oxidase from Aspergillus Flavus with its Substrate Uric Acid by continuous serial electron diffraction (SerialED) | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | Deposition date: | 2025-04-14 |
|
PDBID: | 9qwn | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-04-14 | Release date: | 2026-04-14 |
|
PDBID: | 9ugr | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-13 |
|
PDBID: | 9ugs | Status: | AUTH -- processed, waiting for author review and approval | Title: | Butanol Dehydrogenase | Authors: | Bai, X., Meng, D., Xu, Y.B., Nam, K.H. | Deposition date: | 2025-04-13 | Release date: | 2025-10-13 |
|
PDBID: | 9ugq | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Cryo-EM structure of ClassIII Salivaricin modification enzyme SalKC in the presence of SalA | Authors: | Li, Y., Luo, M., Shao, K., Li, Y. | Deposition date: | 2025-04-13 |
|
PDBID: | 9ugo | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-13 |
|
PDBID: | 9ugt | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Butanol Dehydrogenase in Complex with ADP and Co | Authors: | Bai, X., Meng, D., Nam, K.H., Xu, Y.B. | Deposition date: | 2025-04-13 | Release date: | 2025-10-13 |
|
PDBID: | 9ugu | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-13 |
|
PDBID: | 9ugv | Status: | HPUB -- hold until publication | Title: | CA structure | Authors: | Shuai, G., Xia, Y., Qian, W. | Deposition date: | 2025-04-13 |
|
PDBID: | 9ugw | Status: | HPUB -- hold until publication | Title: | Apo structure | Authors: | Shuai, G., Xia, Y., Qian, W. | Deposition date: | 2025-04-13 |
|
PDBID: | 9ugx | Status: | HPUB -- hold until publication | Title: | Apo structure | Authors: | Shuai, G., Xia, Y., Qian, W. | Deposition date: | 2025-04-13 |
|
PDBID: | 9o6k | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-13 |
|
PDBID: | 9o6i | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-13 |
|
PDBID: | 9o6h | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-13 |
|
PDBID: | 9o6j | Status: | HPUB -- hold until publication | Title: | Structure of Siglec-10 in complex with 2,3-Sialyllactose | Authors: | Medina, E., Ming, Q., Tran, T.H., Luca, V.C. | Deposition date: | 2025-04-13 |
|
PDBID: | 9o6e | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SARS-CoV-2 Mpro S10C in complex with Pfizer Intravenous Inhibitor PF-00835231 | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | Deposition date: | 2025-04-13 |
|