| PDBID: | 9lpk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpt | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpl | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | E. coli FabF mutant -C163Q | | Authors: | Chen, L., Huang, Y. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9lpn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpo | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lps | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 7i09 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000020269204 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4k | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 | | Sequence: | >Entity 1
SMACGLVASNLNLKPGE(CME)LRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEV(CME)ITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIK(CME)VAFD
|
|
| PDBID: | 9i4l | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4m | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Galectin-1 in Complex with Methyl 3''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4n | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4o | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4p | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 in Complex with Methyl 3''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4q | | Status: | HPUB -- hold until publication | | Title: | SSX structure of dye-type peroxidase DtpB from Streptomyces lividans | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9n0k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE triple mutant (Ile12Phe, Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE double mutant (Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n17 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n16 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n19 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
