| PDBID: | 8pvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8k4e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8k4d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8k4g | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-18 | | Release date: | 2025-01-18 |
|
| PDBID: | 8thw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 | | Release date: | 2024-11-17 |
|
| PDBID: | 8thz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8thx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8thy | | Status: | HPUB -- hold until publication | | Title: | yeast actin A167E mutant rabbit-like | | Authors: | Volkmann, N., Hanein, D. | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8puk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8pul | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8pup | | Status: | HPUB -- hold until publication | | Title: | Influenza A/California/07/2009(H1N1) endonuclease in complex with purpurogallin-like compound | | Authors: | Kotacka, T., Radilova, K. | | Deposition date: | 2023-07-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8pv0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8puz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8puu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8puj | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Martinez-Felices, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8k48 | | Status: | HPUB -- hold until publication | | Title: | LTD of arabidopsis thaliana | | Authors: | Wang, C., Xu, X.M. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8tho | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the zinc finger repeat domain of BCL11A (ZnF456) | | Authors: | Viennet, T., Yin, M., Orkin, S.H., Arthanari, H. | | Deposition date: | 2023-07-17 | | Sequence: | >Entity 1
SEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
|
|
| PDBID: | 8thq | | Status: | HPUB -- hold until publication | | Title: | Nonamer RNA bound to hAgo2-PAZ | | Authors: | Pallan, P.S., Harp, J.M., Egli, M. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8pu5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Acyl-CoA dehydrogenase FadE1(PA0506) E441A from Pseudomonas aeruginosa complexed with C16CoA | | Authors: | Wang, M., Brear, P., Welch, M. | | Deposition date: | 2023-07-16 | | Release date: | 2025-01-16 |
|
| PDBID: | 8k3o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8pu1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the toxin/antitoxin complex FaRel/ATfaRel2 with APCPP | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8pu2 | | Status: | HPUB -- hold until publication | | Title: | Structure of the antitoxin ATfaRel2 | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8pu3 | | Status: | HPUB -- hold until publication | | Title: | Complex of the toxin/antitoxin FaRel2/ATfaRel2 | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8pu4 | | Status: | HPUB -- hold until publication | | Title: | FaRel2 bound to the ATP analogue, APCPP | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8ptv | | Status: | HPUB -- hold until publication | | Title: | IPNS variant N252Q in complex with Fe and ACV under anaerobic conditions | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2023-07-15 |
|
