| PDBID: | 9kpd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9kpe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of GPCR16-GiH5 complex | | Authors: | Wang, X., Wu, L.J., Hua, T., Liu, Z.J. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9kpf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of GPCR16-Gi complex | | Authors: | Wang, X., Wu, L.J., Hua, T., Liu, Z.J. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9kp9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PfDXR - Mn2+ - NADPH - TAKK443 quaternary complex | | Authors: | Takada, S., Sakamoto, Y., Tanaka, N. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kpa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Horse spleen L-ferritin mutant (R59F) | | Authors: | Suzuki, T., Hishikawa, Y., Maity, B., Abe, S., Ueno, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kp7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Horse spleen L-ferritin mutant (R59F) with Nile Red | | Authors: | Suzuki, T., Hishikawa, Y., Maity, B., Abe, S., Ueno, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kph | | Status: | HOLD -- hold until a certain date | | Title: | Fusobacterium ncRNA dimer | | Authors: | Tu, Y.F., Shang, S.T., Su, Z.M. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9kpk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kpi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hhj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-21 | | Release date: | 2025-11-21 |
|
| PDBID: | 9hh5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hh6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | A rare open conformation for Ubl2 domain of papain-like protease C111S of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhg | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhi | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease without zinc of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hh4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the family S1_19 carrageenan sulfatase ZgCgsA from Zobellia galactanivorans in complex with hybrid b-k-neocarratetraose | | Authors: | Chevenier, A., Czjzek, M., Michel, G., Ficko-Blean, E. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhe | | Status: | HPUB -- hold until publication | | Title: | Structure of the Ist2 TMEM16 homology domain in the detergent GDN | | Authors: | Arndt, M., Dutzler, R. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hh8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hha | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhc | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Plasmodium falciparum Bromodomain PfBDP1 in complex with MPM2 | | Authors: | Amann, M., Huegle, M., Einsle, O., Guenther, S. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhl | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hh7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
