| PDBID: | 9fb9 | | Status: | HPUB -- hold until publication | | Title: | Dye-decolourising peroxidase DtpB (336 kGy) | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Strange, R.W., Owen, R.L. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9fba | | Status: | HPUB -- hold until publication | | Title: | Dye-decolourising peroxidase DtpB (392 kGy) | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Strange, R.W., Owen, R.L. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zif | | Status: | HPUB -- hold until publication | | Title: | Gamma-lyase CndF in complex with pyridoxal 5''-phosphate, L-homoserine and ethyl acetoacetate | | Authors: | Gao, Y., Tang, Y., Zhou, J. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zib | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zi5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zi7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SrUGT76G4 in complex with Rubusoside | | Authors: | Wang, Y., Li, T., Yin, H. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zi4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of wtEP-trypsinogen | | Authors: | Song, Q.Y., Ding, Z.Y., Huang, H.J. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zi9 | | Status: | HPUB -- hold until publication | | Title: | Human left ventricle actin and myosin complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zia | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zic | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zid | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of free nucleosome asterisk -RFX5 | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zie | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zi6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SrUGT76G4 in complex with UDP-glucose | | Authors: | Wang, Y., Li, T., Yin, H. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8zi8 | | Status: | HPUB -- hold until publication | | Title: | Terephthalate 1,2-cis-dihydrodioldehydrogenase/Decarboxylase in complex with 2,5-Dihydroxybenzoate. | | Authors: | Kumar, K.A., Pahwa, D., Kumar, P. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bs9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bs5 | | Status: | HPUB -- hold until publication | | Title: | Bacteroides ovatus GH97C Sus | | Authors: | Brown, H.A., Koropatkin, N.M. | | Deposition date: | 2024-05-13 | | Sequence: | >Entity 1
MHHHHHHQQKLTSPDGNLVLTFQVNKEGAPTYDLTYKGKVVIKPSTLGLELKKEDNTRTDFDWVDRRDLTKLDSKSNLYNGFKLKDAQTTTFDETWQPVWGEEKEIRNQYNELAVILFQPMNDRSIVVRFRLFNDGLGFRYEFPQQKSLNYFVIKEEHSQFAMAGNHIAYWIPGDYDTQEYDYTISRLSEIRGLMQQAITPNSSQTPFSPTGVQTALMMKTDDGLYINLHEAALIDYSCMHLNLDDKNMIFESWLTPDAKGDKGYMQTPCNSPWRTIIVSDDARNILASRITLNLNEPCKIADAASWIKPVKYIGVWWDMITGKGSWAYTDELTSVKLGVTDYSKTKPNGKHSANTANVKRYIDFAAANGFDAVLVEGWNEGWEDWFGNSKDYVFDFLTAYPDFDVQEIHRYAASKGIKMMMHHETSASVRNYERHLDKAYQFMVDNGYNSVKSGYVGNIIPRGEHHYGQWMNNHYLYAVKKAADYKIMVNAHEATRPTGICRTYPNLIGNESARGTEYESFGGNKVYHTTILPFTRLVGGPMDYTPGIFETHCNQMNPANNSQVRSTIARQLALYVTMYSPLQMAADIPENYERFMDAFQFIKDVALDWDKTIYLEAEPGEYITIARKAKGTDDWYIGCTAGENGHDSQLTFDFLEPGKQYVATVYADAKDADWKDNPQAYTIKKGILNNKSKLNLHAANGGGYAISIKEVKNKSEVKGLKRL
|
|
| PDBID: | 9bs7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor Vinylpyridine | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bs6 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of ThermoCas9 in post-cleavage state with a DNA containing NNNNCGA PAM | | Authors: | Zhao, Y., Shu, Y. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 | | Sequence: | >Entity 1
MNNSKIISKVLLSLSLFTVGASAFVIQDELMQKKHAKAEVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFAHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
|
|
| PDBID: | 9bs8 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-107 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bsl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
