| PDBID: | 9ur3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ur7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9urb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9uqw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of5 | | Status: | HPUB -- hold until publication | | Title: | Structure of the Acinetobacter baumannii Response Regulator PmrA Receiver Domain I13M Mutation | | Authors: | Jaimes, F.E., Milton, M.E., Cavanagh, J. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of4 | | Status: | HPUB -- hold until publication | | Title: | Structure of the Acinetobacter baumannii Response Regulator PmrA Receiver Domain M12I Mutation | | Authors: | Jaimes, F.E., Milton, M.E., Hondros, A.D., Cavanagh, J. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9oex | | Status: | HPUB -- hold until publication | | Title: | K-Ras G12V at 293 K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9oez | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9oey | | Status: | PROC -- to be processed | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9oer | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9oes | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9oet | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9oeu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9oev | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9oew | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9ofc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofa | | Status: | HPUB -- hold until publication | | Title: | The structure of a Fungal Cyanide Hydratase from Gloeocercospora sorghi | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Farah, C.S. | | Deposition date: | 2025-04-29 | | Sequence: | >Entity 1
MPINKYKAAVVTSEPVWENLEGGVVKTIEFINEAGKAGCKLIAFPEVWIPGYPYWMWKVNYLQSLPMLKAYRENSIAMDSSEMRRIRAAARDNQIYVSIGVSEIDHATLYLTQVLISPLGDVINHRRKIKPTHVEKLVYGDGSGDSFEPVTQTEIGRLGQLNCWENMNPFLKSLAVARGEQIHVAAWPVYPDLSKQVHPDPATNYADPASDLVTPAYAIETGTWVLAPFQRISVEGLKRHTPPGVEPETDATPYNGHARIFRPDGSLYAKPAVDFDGLMYVDIDLNESHLTKALADFAGHYMRPDLIRLLVDTRRKELVTEVGGGDNGGIQSYSTMARLGLDRPLEEEDYRQGTDAGETEKASSNGHA
|
|
