| PDBID: | 9etk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9etl | | Status: | HOLD -- hold until a certain date | | Title: | Mouse CNPase catalytic domain with nanobody 8D | | Authors: | Schroder, M., Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | | Deposition date: | 2024-03-26 | | Release date: | 2025-03-26 |
|
| PDBID: | 9etr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9etq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9ets | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9et5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CDK2-cyclin A in complex with FragLite 8 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9et3 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 10 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9et2 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 11 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
| PDBID: | 9eto | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9etp | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 1 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
| PDBID: | 9esi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9ess | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 22 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9etc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with chenodeoxycholic acid | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
| PDBID: | 8yu1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-26 | | Release date: | 2025-03-26 |
|
| PDBID: | 8ytk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human prolyl-tRNA synthetase in complex with inhibitor | | Authors: | Luo, Z., Zhou, H. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytt | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 mature virion | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of actinomycin D and Echinomycin-d(ACGATGCT/AGCACGT) complex | | Authors: | Wu, Y.S., Lee, Y.Y., Hou, M.H. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-26 | | Release date: | 2025-03-26 |
|
| PDBID: | 8yto | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-26 | | Release date: | 2025-03-26 |
|
| PDBID: | 8yu0 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
