PDBID: | 9qpi | Status: | HPUB -- hold until publication | Title: | Isopenicillin N synthase in complex with Fe and ACV | Authors: | Rabe, P., Schofield, C.J., Stead, A. | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpe | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpj | Status: | HPUB -- hold until publication | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SSX | Authors: | Rabe, P., Schofield, C.J., Stead, A. | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpp | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human MATa2 in complex with MAT2B isoform v1 at 2.6 A resolution | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpo | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human MATa2 in complex with MATBv2 at 2.6 A resolution | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpm | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpn | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpd | Status: | HPUB -- hold until publication | Title: | APH(2'''')-IVa with a fragment | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpf | Status: | HPUB -- hold until publication | Title: | Solution structure of Sox2 DBD | Authors: | Orsetti, A., van Ingen, H. | Deposition date: | 2025-03-27 | Sequence: | >Entity 1 GSNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTL
|
|
PDBID: | 9qpl | Status: | HPUB -- hold until publication | Title: | APH(2'''')-IVa with an inhibitor | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | Deposition date: | 2025-03-27 |
|
PDBID: | 9u94 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Fusobacterium nucleatum CbpF in complex with human CEACAM1 | Authors: | Li, L.J., Shen, F., Zhao, X., Gao, G.F. | Deposition date: | 2025-03-27 |
|
PDBID: | 9u93 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Fusobacterium nucleatum CbpF in complex with human CEACAM5 | Authors: | Li, L.J., Shen, F., Zhao, X., Gao, G.F. | Deposition date: | 2025-03-27 |
|
PDBID: | 9u96 | Status: | HPUB -- hold until publication | Title: | SARS-CoV2 Main protease(Mpro) complexed with TAB1 peptide | Authors: | Fu, X. | Deposition date: | 2025-03-27 |
|
PDBID: | 9u95 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2025-03-27 |
|
PDBID: | 9u97 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2025-03-27 |
|
PDBID: | 9u99 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2025-03-27 |
|
PDBID: | 9u9f | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-27 |
|
PDBID: | 9u9g | Status: | HPUB -- hold until publication | Title: | Crystal structure of antitoxin HipB from Pseudomonas fluorescens 2P24 | Authors: | Song, Y.J., Zhang, S.P., Bao, R., He, Y.X. | Deposition date: | 2025-03-27 |
|
PDBID: | 9u9e | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-27 |
|
PDBID: | 9nxv | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9nxw | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Glutathione S-Transferase Bla g 22 | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | Deposition date: | 2025-03-26 |
|
PDBID: | 9nxu | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Glutathione S-Transferase Per a 22 | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | Deposition date: | 2025-03-26 |
|
PDBID: | 9nxt | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Glutathione S-Transferase Per a 21 | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | Deposition date: | 2025-03-26 |
|
PDBID: | 9ny4 | Status: | AUTH -- processed, waiting for author review and approval | Title: | USP21 bound to H2AK119ub nucleosome | Authors: | Rahman, S., Wolberger, C. | Deposition date: | 2025-03-26 |
|
PDBID: | 9ny0 | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|