PDBID: | 8v8r | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Reactive Enamine Deaminase A (RidA) Homolog from an Opportunistic Pathogen, Streptococcus sanguinis. | Authors: | Thomas, L.M., Rajan, R., Somalinga, V., Benedict, A., Aquino, A. | Deposition date: | 2023-12-05 |
|
PDBID: | 8v8k | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-05 |
|
PDBID: | 8v8f | Status: | HPUB -- hold until publication | Title: | The co-crystal structure of anti-HIV scFv and Utag. | Authors: | Chen, S.H., Snow, C.D. | Deposition date: | 2023-12-05 |
|
PDBID: | 8xal | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of SARS-CoV-2 S-BQ.1 in complex with ACE2 | Authors: | Hsu, H.F., Wu, M.H., Chang, Y.C., Hsu, S.T.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8xak | Status: | HPUB -- hold until publication | Title: | Structure of Pif1-G4 complex | Authors: | Hong, Z., Song, H. | Deposition date: | 2023-12-04 |
|
PDBID: | 8xae | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-12-04 | Release date: | 2024-12-04 |
|
PDBID: | 8xad | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-12-04 | Release date: | 2024-12-04 |
|
PDBID: | 8xaf | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-12-04 | Release date: | 2024-12-04 |
|
PDBID: | 8xag | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8xah | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbk | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbh | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rba | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbf | Status: | HPUB -- hold until publication | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbb | Status: | HPUB -- hold until publication | Title: | p53-Y220C Core Domain Covalently Bound to 2,5,6-trifluoropyridine-3-carbonitrile Soaked at 40 mM | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbg | Status: | HPUB -- hold until publication | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbe | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbl | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbp | Status: | HPUB -- hold until publication | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | Deposition date: | 2023-12-04 | Sequence: | >Entity 1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8rbc | Status: | HPUB -- hold until publication | Title: | p53-Y220C Core Domain Covalently Bound to 3-amino-5-chloropyrazine-2,6-dicarbonitrile Soaked at 5 mM | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7s | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7p | Status: | HPUB -- hold until publication | Title: | Crystal structure of the truncated P1 pilin from Pseudomonas aeruginosa | Authors: | Bragagnolo, N.J., Audette, G.F. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7q | Status: | HPUB -- hold until publication | Title: | IpaD (122-321) Pi-helix Mutant (delta Q148) Apo Structure | Authors: | Barker, S.A., Dickenson, N.E., Johnson, S.J. | Deposition date: | 2023-12-04 |
|