PDBID: | 9jvs | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of PHBDD-M1 with 4-formyl-N-methylbenzamide | Authors: | Yang, J. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvl | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of PHBDD-M1-L163G-T234A with N-cyclopropyl-4-methylbenzamide | Authors: | Yang, J., Gao, L., Qiu, X. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jw2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of PHBDD | Authors: | Yang, J. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvy | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of PHBDD-M1 with 1H-pyrrolo[2,3-b]pyridine-4-carbaldehyde | Authors: | Yang, J., Qiu, X. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvi | Status: | HPUB -- hold until publication | Title: | Crystal structure of OsSPS3 complexed with YH24288 | Authors: | Xiao, H., Li, M., Yang, G.-F. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jw6 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-10-09 | Release date: | 2025-10-09 |
|
PDBID: | 9jw3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9jw4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of OsSPS3 complexed with YH24785 | Authors: | Xiao, H., Li, M., Yang, G.-F. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvo | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvr | Status: | HPUB -- hold until publication | Title: | De novo designed GFP 1GFL-15 | Authors: | Guo, Z., Liu, J.L., Lai, L.H. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jw0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9jw5 | Status: | HPUB -- hold until publication | Title: | Crystal structure of OsSPS3 complexed with YH24786 | Authors: | Xiao, H., Li, M., Yang, G.-F. | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwa | Status: | HPUB -- hold until publication | Title: | Crystal structure of FABLE, MPD condition | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwb | Status: | HPUB -- hold until publication | Title: | Crystal structure of FABLE, PEG 400 condition | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwc | Status: | HPUB -- hold until publication | Title: | Crystal structure of FABLE, PEG 600 condition | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-10-09 |
|
PDBID: | 9h1n | Status: | HPUB -- hold until publication | Title: | Dihydrolipoamide Acetyltransferase (E2) PSBD in complex with the Pyruvate Dehydrogenase (E1) binding domain from E. coli | Authors: | Bothe, S.N., Racunica, D., Glockshuber, R. | Deposition date: | 2024-10-09 |
|
PDBID: | 9h11 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9h12 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9h10 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9h0t | Status: | HPUB -- hold until publication | Title: | N terminal domain of BC2L-C lectin (1-131) in complex with a beta-fucosylamide side-product | Authors: | Antonin, G., Varrot, A. | Deposition date: | 2024-10-09 | Sequence: | >Entity 1 GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
PDBID: | 9h0u | Status: | HPUB -- hold until publication | Title: | N terminal domain of BC2L-C lectin (1-131) with covalent beta-fucosylamide ligand | Authors: | Antonini, G., Varrot, A. | Deposition date: | 2024-10-09 | Sequence: | >Entity 1 GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
PDBID: | 9h1g | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-10-09 | Release date: | 2025-10-09 |
|
PDBID: | 9h13 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9h0z | Status: | HPUB -- hold until publication | Title: | Crystal structure of TTL[Nle], thermophilic lipase TTL from Thermoanaerobacter thermohydrosulfuricus containing non-canonical amino acid Nle at the position of Met | Authors: | Hromic-Jahjefendic, A., Pavkov-Keller, T., Wiltschi, B., Gruber, K. | Deposition date: | 2024-10-09 |
|
PDBID: | 9h14 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|