| PDBID: | 9veu | | Status: | HPUB -- hold until publication | | Title: | Structure of the magnesium channel CorA from Mycobacterium tuberculosis in the presence of Mg2+ | | Authors: | Chen, X., Li, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf0 | | Status: | HPUB -- hold until publication | | Title: | Structure of the magnesium channel CorA from Mycobacteria smegmatis in the presence of Mg2+ | | Authors: | Chen, X., Li, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the magnesium channel CorA from Mycobacteria smegmatis in the resting state | | Authors: | Chen, X., Li, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vez | | Status: | HPUB -- hold until publication | | Title: | Structure of the magnesium channel CorA from Mycobacteria smegmatis in the presence of 1 mM EDTA | | Authors: | Chen, X., Li, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vep | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Klebsiella pneumoniae SuhB | | Authors: | Jena, A.K., Yadav, V.K., Bhattacharyya, S. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vew | | Status: | HPUB -- hold until publication | | Title: | SIRT2 structure in complex with H3K18myr peptide and native NAD: pre-catalysis state 2 | | Authors: | Zhang, N., Hao, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vex | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of CpaO in complex with beta-CPA | | Authors: | Chang, C.Y., Cheng, T., Kuo, Y.M., Hsiao, P.Y., Wang, M., Wang, N. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytochrome P450 CYP153A99 from Pseudomonas sp. 19-rlim, complexed with dehydroabietic acid | | Authors: | Liu, X.D., Dong, L.-B. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfa | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf9 | | Status: | HPUB -- hold until publication | | Title: | GSTM1 in complex with bithionol | | Authors: | Sun, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9ves | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ube2E3 | | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
| PDBID: | 9p1p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the apo form of CLZ9 from Streptomyces | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TCZ9 from Streptomyces | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Staphylococcus aureus ClpP in complex with chimerabactin | | Authors: | Lee, R.E., Griffith, E.C. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TCZ9 bound with Cannabigerolic acid (CBGA) | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1i | | Status: | HPUB -- hold until publication | | Title: | Atomic structure of vibrio effector fragment VopV bound to Beta-cytoplasmic/gamma1-cytoplasmic F-actin | | Authors: | Kreutzberger, M.A., Kudryashova, E., Egelman, E.H., Kudryashov, D.S. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1u | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | A2AR-BRIL in complex with ZM241385 | | Authors: | Rao, P., Rathinaswamy, M., Chan, M., Paredes, A.G., Patel, C., Wranik, B.J., Powell, J., Eaton, D., Hicks, K.J., Mafi, A., Hao, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of sensory domain of CdgA from Vibrio cholerae O1 biovar El Tor str. N16961 | | Authors: | Marceau, A.H., Mariscal, V.T., Tripathi, S.M., Yildiz, F.H., Rubin, S.M. | | Deposition date: | 2025-06-10 |
|
