| PDBID: | 9ep3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ype | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of inactive p38 complexed with a ATF2 from 46 to 80 | | Authors: | Zhang, Y.Y., Pei, C.J., He, Q.Q., Luo, Z.P., Wu, J.W., Wang, Z.X. | | Deposition date: | 2024-03-16 | | Release date: | 2025-03-16 |
|
| PDBID: | 8ypf | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of inactive p38 complexed with a ATF2 from 46 to 90 | | Authors: | Zhang, Y.Y., Pei, C.J., He, Q.Q., Luo, Z.P., Wu, J.W., Wang, Z.X. | | Deposition date: | 2024-03-16 | | Release date: | 2025-03-16 |
|
| PDBID: | 8ypc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in phosphorylated state | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ypd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the LH1 complex from Allochromatium tepidum | | Authors: | Wang, G.-L., Sun, S., Yu, L.-J. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ypb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ypa | | Status: | HPUB -- hold until publication | | Title: | Human mitochondrial ClpP in complex with TR89 | | Authors: | Li, Q.-N., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9eoz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9ep0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9ep2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of human carbonic anhydrase I with 4-sulfamoylphenyl 3-(p-tolylthio)propanoate | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-03-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9eok | | Status: | POLC -- waiting for a policy decision | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eom | | Status: | HPUB -- hold until publication | | Title: | 250A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eon | | Status: | HPUB -- hold until publication | | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eov | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp8 | | Status: | HOLD -- hold until a certain date | | Title: | Structural and mechanistic insights into the allosteric activation of p38alpha MAP kinase via specific docking interactions | | Authors: | Zhang, Y.Y., Pei, C.J., He, Q.Q., Luo, Z.P., Wu, J.W., Wang, Z.X. | | Deposition date: | 2024-03-15 | | Release date: | 2025-03-15 |
|
| PDBID: | 8yp6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM map of 30S ribosomal subunit in complex with MetAP1c of Mycobacterium smegmatis | | Authors: | Banerjee, A., Sengupta, J. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp9 | | Status: | HPUB -- hold until publication | | Title: | the crystal structure of wildtype Magnaporthe grisea oxidoreductase in complex with NADP | | Authors: | Huang, X., Jiang, H., Tang, D., Lin, S. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glucosyltransferase RrUGT3 | | Authors: | Cai, Y. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp4 | | Status: | HPUB -- hold until publication | | Title: | Structure of MAP2K1 complexed with 5Z7-oxozeaenol | | Authors: | Yumura, S., Kinoshita, T. | | Deposition date: | 2024-03-15 |
|
