PDBID: | 9eg7 | Status: | HPUB -- hold until publication | Title: | X-ray diffraction structure of papain co-crystallized with E64-C | Authors: | Vlahakis, N.W., Rodriguez, J.A., Tang, Y. | Deposition date: | 2024-11-20 |
|
PDBID: | 9eg0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efy | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9eg2 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-11-20 |
|
PDBID: | 9efv | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of CSN-N8CUL1 in complex with CSN5i-3 | Authors: | Shi, H., Zheng, N. | Deposition date: | 2024-11-20 |
|
PDBID: | 9efq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-2 | Authors: | Shi, H., Zheng, N. | Deposition date: | 2024-11-20 |
|
PDBID: | 9eg3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efa | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9eg1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | COP9 signalosome deneddylation complex with cullin-5 | Authors: | Shi, H., Zheng, N. | Deposition date: | 2024-11-20 |
|
PDBID: | 9eft | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efg | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9eff | Status: | HPUB -- hold until publication | Title: | Crystal Structure of a nucleoid-associated protein (UBP) bound to DNA from Sulfolobus islandicus. | Authors: | Dhanaraju, R., Gonzalez-Gutierrez, G., Bell, S.D. | Deposition date: | 2024-11-20 |
|
PDBID: | 9efh | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efn | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of Saccharomyces cerevisiae cross-linked Sfh1 (K197C, F233C) mutant in complex with phosphatidylethanolamine | Authors: | Green, S.M., Laganowsky, A., Krieger, I., Singh, P.K., Igumenova, T.I., Bankaitis, V.A., Sacchettini, J. | Deposition date: | 2024-11-20 | Release date: | 2025-11-20 |
|
PDBID: | 9efb | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efs | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efe | Status: | HPUB -- hold until publication | Title: | Crystal Structure in space group P21 of a nucleoid-associated protein (UBP) from Sulfolobus islandicus. | Authors: | Dhanaraju, R., Gonzalez-Gutierrez, G., Bell, S.D. | Deposition date: | 2024-11-20 | Sequence: | >Entity 1 HMIVMRVKVNEKQFDMIIDKLKLMVYEYNTKIKEYGVYLKPYHIVYKNSKRYIYIGKYWYKLEKIGGKLKWIYLGKTKPIQNMPNPPQIPESTIIKEDNEYIVDEKILYDLE
|
|
PDBID: | 9efk | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efj | Status: | HPUB -- hold until publication | Title: | Histidine-covalent alpha-helical peptide (compound 6) targeting hMcl-1 | Authors: | Muzzarelli, K.M., Assar, Z., Alboreggia, G., Udompholkul, P., Pellecchia, M. | Deposition date: | 2024-11-20 |
|
PDBID: | 9eg4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efp | Status: | HOLD -- hold until a certain date | Title: | Crystal Structure of Saccharomyces cerevisiae Sec14p in complex with phosphatidylcholine | Authors: | Green, S.M., Laganowsky, A., Krieger, I., Singh, P.K., Igumenova, T.I., Bankaitis, V.A., Sacchettini, J. | Deposition date: | 2024-11-20 | Release date: | 2025-11-20 |
|
PDBID: | 9efu | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efl | Status: | HPUB -- hold until publication | Title: | Structure of a GH16_17 carrageenase from a metagenomic dataset. | Authors: | Boraston, A.B., Tingley, J., Mihalynuk, L., Abbott, D.W. | Deposition date: | 2024-11-20 |
|
PDBID: | 9efz | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-20 |
|
PDBID: | 9efd | Status: | HPUB -- hold until publication | Title: | Crystal Structure in space group C2221 of a nucleoid-associated protein (UBP) from Sulfolobus islandicus. | Authors: | Dhanaraju, R., Gonzalez-Gutierrez, G., Bell, S.D. | Deposition date: | 2024-11-20 |
|