| PDBID: | 9ijr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ijs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ijn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ijq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ijv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ijt | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human Programmed cell death 1 ligand 1 (PD-L1) bound to Small molecule inhibitor Compound-20 | | Authors: | Swaminathan, S., Birudukota, S., Vaithilingam, K., Sadhu, N., Gosu, R., Rajagopal, S. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ijo | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of F46C myoglobin with a covalently linked 4-methyl-2,2''-bipyridine group in complex with Cu2+ | | Authors: | Lin, Y.W. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ijz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9iju | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ijx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse Spef1 coiled-coil domain | | Authors: | Ren, J., Li, D., Feng, W. | | Deposition date: | 2024-06-25 | | Sequence: | >Entity 1
GPGSYNQALQGDPSFVLQIAEKEQELLASQETVQVLQMKVKRLEHLLQLKNVRIDDLSRRLQQAERKQR
|
|
| PDBID: | 9ijy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ijw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ce0 | | Status: | HPUB -- hold until publication | | Title: | DosP Apo Bent form | | Authors: | Kumar, P., Kober, D.L. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cds | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OspA ST1 from B. burgdorferi bound to monoclonal antibody LA-2 | | Authors: | Laciak, A.R., Lai, Y.-T., Dhingra, Y. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DLK with inhibitor bound | | Authors: | Skene, R.J., Bell, J.A. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdk | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Mpro A173V mutant in complex with small molecule inhibitor Mpro61 | | Authors: | Tang, S., Kenneson, J.R., Anderson, K.S. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdl | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Mpro E166V/L50F double mutant in complex with small molecule inhibitor Mpro61 | | Authors: | Tang, S., Kenneson, J.R., Huynh, K., Anderson, K.S. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DLK with inhibitor bound | | Authors: | Skene, R.J., Bell, J.A. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdm | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Mpro L50F mutant in complex with small molecule inhibitor Mpro61 | | Authors: | Tang, S., Kenneson, J.R., Huynh, K., Anderson, K.S. | | Deposition date: | 2024-06-25 |
|
