| PDBID: | 9fvq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ike | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CDK12/Cyclin K in complex with covalent inhibitor | | Authors: | Huang, W.X., Zhou, K.J., Yang, J.Z., Ding, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikf | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Carbon Dioxide-bound Fully Oxidized State | | Authors: | Muramoto, K., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikg | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Carbon Dioxide-bound Fully Reduced State | | Authors: | Muramoto, K., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikh | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Nitrous Oxide-bound Fully Oxidized State | | Authors: | Muramoto, K., Ide, T., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9iki | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Nitrous Oxide-bound Fully Reduced State | | Authors: | Muramoto, K., Ide, T., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of heterotrimeric Kinesin-2 | | Authors: | Ren, J., Zhao, L., Feng, W. | | Deposition date: | 2024-06-27 | | Sequence: | >Entity 1
HHHHSQDGGAYSDERQDLDQTIAEVSKELKLKLLIVENFIPRDVSERIKERAEWNEDSFEWNVNAFQSTSSNSSTPLNNTIEVNEDGVFTRSSGADSGVSVSGGNGTPATSQFLDKRLVATPGCRRPMSMCERMLVETAREQFGAQRRPPISGSGSFVEATIPEETIRFCGENVVVFSALERFVPEVTDSDPSTFSNSMMMSARRPSIENLTIDASKVLVPILNQSTMILKNSKNGQARNDTMPPNGSMRRSQN
>Entity 2
EDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPVEHVELIEKYVSWSEEHGDWQLKAIAYTGNNMRASAPPAKKEFSNNNQTVPMYYSYRADLGASTAEHRPRTSSKKHRASIRLQQLLT
>Entity 3
ELGKIDEYIECFYGETSVEKNKGAVALYELSKNPQNLTQLVNNETLMMALARVFREDWKKHFEVGTNIMNLFVNISKFSCLHGILLHHKIGTLCVNAMEHETKRYDFWIAEMKKTDQETLRKLKTAIRKQAMLLAACVTFLTNLATDISVELKMVRRNLVALLVKCLQMSSESTSSLTTATIKFLLKLSIFDENKIVMEQNGTIEKLLKLFPIQDPELRKAVIMLLFNFSFDSKNLPKMVNGGLVPHMASLLDSDTKALNMMYLLSCNDDAKAMLAYTDAIKLLMKDVLSGTGSEVTKAVLLNICLEKRNAQLVCGQRGQGLDLLMEMSINSRDLMLIKVVRAISSHEGATQNMFLKWIETLIGIAKNEGADNSESKSSFGLECMGTVAELKVAPWAKIIQSENLVPWMKTQLQEGIDESEEVTVLRDIKPLQLQIVIACGTMARQLDAARLLAPLIDTFVQLLQSCQIDDEFVVQLLYVFLQFLKHKELSARLMTQDSALGAHMIDLMHDANAVVREVCDNALLIMGEHSKEWAKRIAGERFKWHNAQWLEMVERDDSEFVDYDDEDFGADLKFDHYDDGFDMNEPLF
|
|
| PDBID: | 9ikd | | Status: | HOLD -- hold until a certain date | | Title: | The apo structure of the MazF-mt3 toxin | | Authors: | Xie, W., Jiang, P. | | Deposition date: | 2024-06-27 | | Release date: | 2025-06-27 |
|
| PDBID: | 9ikj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cfu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of myosin-1c bound to F-actin in the ADP-A state | | Authors: | Chavali, S.S., Sindelar, C.V., Ostap, E.M. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cfx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of myosin-1c bound to F-actin in the Rigor state | | Authors: | Chavali, S.S., Sindelar, C.V., Ostap, E.M. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cft | | Status: | HPUB -- hold until publication | | Title: | Adeno-associated virus serotype 6 basic regions in complex with importin alpha 2 | | Authors: | Hoad, M., Forwood, J.K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cfn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cfe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cf4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cff | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Refinement of Antibody 19-77 in complex with SARS-CoV-2 HK.3 RBD | | Authors: | Casner, R.G., Shapiro, L. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cf9 | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 3CL Protease complexed with covalent inhibitor BC787 | | Authors: | Hoffpauir, Z.A., Meneely, K.M., Lamb, A.L. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cfa | | Status: | HPUB -- hold until publication | | Title: | Germline-targeting HIV-1 gp120 engineered outer domain eODgt8 in complex with Fab eOD-CL04.1 | | Authors: | Sarkar, A., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cf6 | | Status: | HPUB -- hold until publication | | Title: | Germline-targeting HIV-1 gp120 engineered outer domain eODgt8 in complex with Fab eOD-CL02.1 | | Authors: | Sarkar, A., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cf7 | | Status: | HPUB -- hold until publication | | Title: | Germline-targeting HIV-1 gp120 engineered outer domain eODgt8 in complex with Fab eOD-PL01.1 | | Authors: | Sarkar, A., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cf5 | | Status: | HPUB -- hold until publication | | Title: | STRUCTURE OF CD4 MIMETIC CJF-III-288 IN COMPLEX WITH BG505 SOSIP.664 HIV-1 ENV TRIMER AND 17B FAB | | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-06-27 |
|
