| PDBID: | 9bvf | | Status: | HPUB -- hold until publication | | Title: | Identification of multiple ligand hotspots on SOS2, compound 6 | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bve | | Status: | HPUB -- hold until publication | | Title: | Identification of multiple ligand hotspots on SOS2, compound 9 | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvn | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bv7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bv9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bva | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bw5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvy | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-20 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bvw | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 main protease bound to inhibitor SR-B-103 | | Authors: | Liu, W.R., Blankenship, L.R. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 9bvx | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 main protease bound to inhibitor YR-C-155 | | Authors: | Liu, W.R., Blankenship, L.R. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
