| PDBID: | 8v6a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v6f | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v6c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v6e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v6b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v5u | | Status: | HPUB -- hold until publication | | Title: | Human SIRT3 bound to p53-AMC peptide and Honokiol | | Authors: | Chakrabarti, R., Ghosh, A., Guan, X., Upadhyay, A., Dumpati, R.K., Munshi, S., Roy, S., Chall, S., Rahnamoun, A., Reverdy, C., Errasti, G., Delacroix, T. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
>Entity 2
QPK(FDL)
|
|
| PDBID: | 8v65 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2025-06-01 |
|
| PDBID: | 8v66 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2025-06-01 |
|
| PDBID: | 8v67 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2025-06-01 |
|
| PDBID: | 8v68 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2025-06-01 |
|
| PDBID: | 8v69 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2025-06-01 |
|
| PDBID: | 8v5v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v60 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v63 | | Status: | HOLD -- hold until a certain date | | Title: | R207A mutant of human Slo1 in presence of EDTA - activated VSD | | Authors: | Pal, K., Kallure, G.S., Chowdhury, S. | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v64 | | Status: | HOLD -- hold until a certain date | | Title: | RCK1-RCK2 double mutant of human Slo1 in presence of EDTA - resting VSD | | Authors: | Pal, K., Kallure, G.S., Chowdhury, S. | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8x9r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Xanthomonas oryzae pv. oryzae NADH-quinone oxidoreductase subunits NuoE and NuoF | | Authors: | Li, L., Ran, T., Wang, W., Zhang, F. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C-hexon capsomer of the VZV B-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Penton capsomer of the VZV B-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa1 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Portal vertex capsomer of VZV B-capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | penton capsomer of the VZV C-capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
