| PDBID: | 8wj3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wj5 | | Status: | HPUB -- hold until publication | | Title: | Double-wing domain of E. coli YdcD | | Authors: | Kamata, K., Tame, J.R.H. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wjf | | Status: | HPUB -- hold until publication | | Title: | Unlocking Immunogenic Potential: Innovating a Peptide/Ferritin Fusion Tag Nano-Delivery Platform from de novo design to Significantly Enhance Antigenicity of the Rabies Virus Glycoprotein Domain III | | Authors: | Fu, D., Wang, M., Guo, Y. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wiw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wi6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-ZSM824 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8ubs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NrdJ-1 split intein fusion | | Authors: | Kofoed, C., Ye, X., Jeffrey, P.D., Muir, T.W. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8ubq | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-24 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8ubt | | Status: | HPUB -- hold until publication | | Title: | Structure of SCF-FBXL17-BACH1BTB E3 ligase complex | | Authors: | Shi, H., Cao, S. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wia | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463S | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wig | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463S/Q484A | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wih | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with ATP | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wii | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with Obafluorin | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wij | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant L489M in complex with Obafluorin | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wie | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8ubj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8wht | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
