| PDBID: | 9mrr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of KwaA with C4 symmetry | | Authors: | Zhang, Z., Patel, D.J. | | Deposition date: | 2025-01-08 |
|
| PDBID: | 9mrx | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of KwaA-KwaB complex | | Authors: | Zhang, Z., Patel, D.J. | | Deposition date: | 2025-01-08 |
|
| PDBID: | 9mra | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9mr5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hx9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hx6 | | Status: | HPUB -- hold until publication | | Title: | CK2 catalytic subunit Alpha''C336S in complex with F2X entry screen fragment F02 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hx7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxo | | Status: | HPUB -- hold until publication | | Title: | A01 mAbs bound to cobratoxin at pH 6.0 | | Authors: | Wade, J.W., Bohn, M.F., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hx5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hx8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lei | | Status: | HPUB -- hold until publication | | Title: | Nitrile synthetase ArtA | | Authors: | Ma, H.L., Zhang, K.K. | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9le8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lea | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lef | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
