| PDBID: | 9hzz | | Status: | HPUB -- hold until publication | | Title: | 305 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i00 | | Status: | HPUB -- hold until publication | | Title: | 320 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i01 | | Status: | HPUB -- hold until publication | | Title: | 345 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Huesgen, P., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i09 | | Status: | HOLD -- hold until a certain date | | Title: | The Paulinella chromatophore transit peptide part2 (crTPpart2) of RnaH | | Authors: | Klimenko, V., Reiners, J., Applegate, V., Reimann, K., Hoeppner, A., Smits, S.H.J., Nowack, E.C.M. | | Deposition date: | 2025-01-14 | | Release date: | 2026-01-14 |
|
| PDBID: | 9i08 | | Status: | HOLD -- hold until a certain date | | Title: | The Paulinella chromatophore transit peptide part2 (crTPpart2) from ArgC | | Authors: | Klimenko, V., Reiners, J., Applegate, V., Reimann, K., Hoeppner, A., Smits, S.H.J., Nowack, E.C.M. | | Deposition date: | 2025-01-14 | | Release date: | 2026-01-14 |
|
| PDBID: | 9i0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i0e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i07 | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A8B8 glycerldeyde-3-phosphate dehydrogenase hexadecamer (major conformer) from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F. | | Deposition date: | 2025-01-14 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i0a | | Status: | HOLD -- hold until a certain date | | Title: | CARM1 in complex with arg-aDMA analog | | Authors: | Cura, V., Dursun, E., Troffer, N., Cavarelli, J. | | Deposition date: | 2025-01-14 | | Release date: | 2026-01-14 |
|
| PDBID: | 9i0b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzm | | Status: | HPUB -- hold until publication | | Title: | 235 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lii | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | structure of phage T4 topoisomerase II central domain | | Authors: | Chen, Y.T., Xin, Y.H. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9ljc | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of a multiple myeloma patient (case 2). | | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lja | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of a multiple myeloma patient (case 1)- polymorph 1. | | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9ljb | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of a multiple myeloma patient (case 1)- polymorph 2. | | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lic | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo form of protein tyrosine phosphatase 1B (PTP1B) | | Authors: | Do, H., Hwang, J., Lee, J.H. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lif | | Status: | HPUB -- hold until publication | | Title: | Repetitive domain (RP) 1 structure of aciniform spidroin from Latrodectus hesperus | | Authors: | Yang, R., Qin, R., Yuan, W., Lin, Z. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lj9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lih | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae Mitochondrial Respiratory Complex II in cyclobutrifluram-bound state | | Authors: | Li, Z.W., Ye, Y., Yang, G.F. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lig | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae Mitochondrial Respiratory Complex II in Y19315-bound state | | Authors: | Li, Z.W., Ye, Y., Yang, G.F. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lij | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of oxidized form (C92-C121) of protein tyrosine phosphatase 1B (PTP1B) | | Authors: | Do, H., Hwang, J., Lee, J.H. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lie | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lit | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
