PDBID: | 8kbl | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 8kbi | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 8q3t | Status: | HPUB -- hold until publication | Title: | HsNMT1 in complex with both MyrCoA and GNCFSKPRVPTK inhibitor peptide | Authors: | Dian, C., Giglione, C., Meinnel, T. | Deposition date: | 2023-08-04 |
|
PDBID: | 8q3s | Status: | HPUB -- hold until publication | Title: | HsNMT1 in complex with both MyrCoA and GNCFSKAR inhibitor peptide | Authors: | Dian, C., Giglione, C., Meinnel, T. | Deposition date: | 2023-08-04 |
|
PDBID: | 8toy | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2025-02-04 |
|
PDBID: | 8tox | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 |
|
PDBID: | 8toz | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 |
|
PDBID: | 8tp0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 |
|
PDBID: | 8q2z | Status: | HPUB -- hold until publication | Title: | HsNMT1 in complex with both MyrCoA and GNLLSKFR peptide | Authors: | Dian, C., Giglione, C., Meinnel, T. | Deposition date: | 2023-08-03 |
|
PDBID: | 8kas | Status: | AUTH -- processed, waiting for author review and approval | Title: | Sus scrofa complex I open state 1 from supercomplex I+III2+IV in the presence of proguanil | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | Deposition date: | 2023-08-03 |
|
PDBID: | 8kay | Status: | AUTH -- processed, waiting for author review and approval | Title: | Sus scrofa complex I open state 2 from supercomplex I+III2+IV in the presence of proguanil | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | Deposition date: | 2023-08-03 |
|
PDBID: | 8kb3 | Status: | HPUB -- hold until publication | Title: | Superoxide dismutase | Authors: | Zhai, L., Li, B.Q., Jia, H.H. | Deposition date: | 2023-08-03 |
|
PDBID: | 8kap | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-03 | Release date: | 2024-08-03 |
|
PDBID: | 8kaq | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-03 | Release date: | 2024-08-03 |
|
PDBID: | 8kao | Status: | HPUB -- hold until publication | Title: | Glutamate dehydrogenase-69O | Authors: | Sakuraba, H., Ohshima, T. | Deposition date: | 2023-08-03 |
|
PDBID: | 8kar | Status: | HPUB -- hold until publication | Title: | Glutamate dehydrogenase-AKG | Authors: | Sakuraba, H., Ohshima, T. | Deposition date: | 2023-08-03 |
|
PDBID: | 8toh | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-03 |
|
PDBID: | 8to9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-03 |
|
PDBID: | 8tog | Status: | HPUB -- hold until publication | Title: | X-Ray Structure Determination of Dihydromethanopterin Reductase (DmrA) from Methylobacterium extorquens AM1 in a P6522 Space Group at a Resolution of 1.56 Angstroms | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbing, M., Collazo, M.J., Potla, S. | Deposition date: | 2023-08-03 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8to7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-03 |
|
PDBID: | 8top | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of HIV-1 Env BG505 DS-SOSIP in complex with antibody GPZ6-b.01 targeting the fusion peptide | Authors: | Zhou, T., Morano, N.C., Roark, R.S., Kwong, P.D. | Deposition date: | 2023-08-03 |
|
PDBID: | 8ton | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-03 | Release date: | 2024-08-03 |
|
PDBID: | 8q2i | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-02 | Release date: | 2025-02-02 |
|
PDBID: | 8q2h | Status: | HPUB -- hold until publication | Title: | beta-galactosidase from Bacillus circulans | Authors: | Kascakova, B., Hovorkova, M., Petraskova, L., Novacek, J., Pinkas, D., Gardian, Z., Kren, V., Bojarova, P., Kuta Smatanova, I. | Deposition date: | 2023-08-02 |
|
PDBID: | 8q2n | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-02 |
|