| PDBID: | 8qk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u79 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of Substrate Binding Protein of Thermus thermophilus TAXI-TRAP protein with L-glutamate | | Authors: | Antony, I.R., Currie, M., Dobson, R. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u70 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u6z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u77 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u71 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u76 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8wcy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-14 | | Release date: | 2024-09-14 |
|
| PDBID: | 8wcw | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-14 | | Release date: | 2024-09-14 |
|
| PDBID: | 8wcx | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-14 | | Release date: | 2024-09-14 |
|
| PDBID: | 8wcz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-14 | | Release date: | 2024-09-14 |
|
| PDBID: | 8wcv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8wd9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis DppABCD in apo form | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8wda | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the substrate-bound DppABCD complex | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8wdb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the ATP-bound DppABCD complex | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8wd7 | | Status: | HOLD -- hold until a certain date | | Title: | Structural organization of the palisade layer in isolated vaccinia virus cores | | Authors: | Liu, Y., Qu, X., Duan, M., Shi, X., Liu, S., Shi, Y., Gao, G.F. | | Deposition date: | 2023-09-14 | | Release date: | 2024-09-14 | | Sequence: | >Entity 1
MMPIKSIVTLDQLEDSEYLFRIVSTVLPHLCLDYKVCDQLKTTFVHPFDILLNNSLGSVTKQDELQAAISKLGINYLIDTTSRELKLFNVTLNAGNIDIINTPINISSETNPIINTHSFYDLPPFTQHLLNIRLTDTEYRARFIGGYIKPDGSDSMDVLAEKKYPDLNFDNTYLFNILYKDVINAPIKEFKAKIVNGVLSRQDFDNLIGVRQYITIQDRPRFDDAYNIADAARHYGVNLNTLPLPNVDLTTMPTYKHLIMFEQYFIYTYDRVDIYYNGNKMLFDDEIINFTISMRYQSLIPRLVDFFPDIPVNNNIVLHTRDPQNAAVNVTVALPNVQFVDINRNNKFFINFFNLLAKEQRSTAIKVTKSMFWDGMDYEEYKSKNLQDMMFINSTCYVFGLYNHNNTTYCSILSDIISAEKTPIRVCLLPRVVGGKTVTNLISETLKSISSMTIREFPRKDKSIMHIGLSETGFMRFFQLLRLMADKPHETAIKEVVMAYVGIKLGDKGSPYYIRKESYQDFIYLLFASMGFKVTTRRSIMGSNNISIISIRPRVTKQYIVATLMKTSCSKNEAEKLITSAFDLLNFMVSVSDFRDYQSYRQYRNYCPRYFYAG
|
|
| PDBID: | 8wdc | | Status: | HOLD -- hold until a certain date | | Title: | Structural organization of the palisade layer in intracellular mature vaccinia virions | | Authors: | Liu, Y., Qu, X., Duan, M., Shi, X., Liu, S., Shi, Y., Gao, G.F. | | Deposition date: | 2023-09-14 | | Release date: | 2024-09-14 | | Sequence: | >Entity 1
MMPIKSIVTLDQLEDSEYLFRIVSTVLPHLCLDYKVCDQLKTTFVHPFDILLNNSLGSVTKQDELQAAISKLGINYLIDTTSRELKLFNVTLNAGNIDIINTPINISSETNPIINTHSFYDLPPFTQHLLNIRLTDTEYRARFIGGYIKPDGSDSMDVLAEKKYPDLNFDNTYLFNILYKDVINAPIKEFKAKIVNGVLSRQDFDNLIGVRQYITIQDRPRFDDAYNIADAARHYGVNLNTLPLPNVDLTTMPTYKHLIMFEQYFIYTYDRVDIYYNGNKMLFDDEIINFTISMRYQSLIPRLVDFFPDIPVNNNIVLHTRDPQNAAVNVTVALPNVQFVDINRNNKFFINFFNLLAKEQRSTAIKVTKSMFWDGMDYEEYKSKNLQDMMFINSTCYVFGLYNHNNTTYCSILSDIISAEKTPIRVCLLPRVVGGKTVTNLISETLKSISSMTIREFPRKDKSIMHIGLSETGFMRFFQLLRLMADKPHETAIKEVVMAYVGIKLGDKGSPYYIRKESYQDFIYLLFASMGFKVTTRRSIMGSNNISIISIRPRVTKQYIVATLMKTSCSKNEAEKLITSAFDLLNFMVSVSDFRDYQSYRQYRNYCPRYFYAG
|
|
| PDBID: | 8qjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjk | | Status: | HPUB -- hold until publication | | Title: | Structure of the cytoplasmic domain of csx23 from Vibrio cholera in complex with cyclic tetra-adenylate (cA4) | | Authors: | McMahon, S.A., McQuarrie, S., Gloster, T.M., Gruschow, S., White, M.F. | | Deposition date: | 2023-09-13 | | Sequence: | >Entity 1
GANAMDEITVVLKSPNGKNIKCPPMPRKDFSRAEVLGYIGMCSGAQRFEIASLKTPKFGENLLKIIKSKGSQSFIVDCTDEEIDQFSAETKSGSNA
>Entity 2
AAAA
|
|
| PDBID: | 8qjl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
